KEGG   Candida dubliniensis: CD36_30070Help
Entry
CD36_30070        CDS       T01140                                 

Definition
UDP-glucose pyrophosphorylase, putative (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cdu  Candida dubliniensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CD36_30070
   00052 Galactose metabolism
    CD36_30070
   00500 Starch and sucrose metabolism
    CD36_30070
   00520 Amino sugar and nucleotide sugar metabolism
    CD36_30070
Enzymes [BR:cdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CD36_30070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R:complement(join(1005756..1007213,1007333..1007377))
Genome map
AA seq 500 aa AA seqDB search
MATTGKRHAKSQSTYAFDNTATNVTASQMRNALNNLADTVENPEQKNRFENEMDNFFSLF
RRYLTEKASGSTLDWDKIRSPSSDEVVEYGDLNSSNTSANLSKLAVLKLNGGLGTSMGCV
GPKSVIEVRDGNNFLDLAVRQIEHLNRKYDADVPLLLMNSFNTDADTAKIIKKYQSHRIR
VKTFNQSRFPRIYKDSLLPVPESFDDSLEAWYPPGHGDLFEALVQSGELDALLAQGREIL
FVSNGDNLGATVDSKILDHMIETGAEYIMELTPKTRADVKGGTLINYQGEVRLLEIAQVP
KEHVEEFKSIKKFKYFNTNNLWINLRAIKKLVEANAIEVEIIPNQKTISHGKSDINVLQL
ETAVGAAIRHFKGAHGVVVPRSRFLPVKTCSDLLLVKSDLFYLEHGALVLDPTRDGFSNP
LIKLGSHFKKVSGFQSRIPYIPKILELDHLTITGNVTIGKGVQLKGTVIIVCNDGDKIDI
PNGAILENVVVTGNLTILEH
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcaactacaggaaaaagacatgcaaaatcacaatcaacatatgcatttgacaacact
gcaaccaatgttaccgcctctcaaatgcgtaatgcattgaacaacttggccgatactgtt
gaaaacccagaacaaaagaacagattcgaaaatgaaatggacaatttcttttctttgttc
agaagatatttgacagaaaaagcatctggatccactttagattgggacaaaatcagatcc
ccatcttctgacgaagttgttgaatatggtgacttgaacagcagcaacacctctgctaat
ttatccaaattggcagttttgaaattgaatggtggtttgggtacttctatgggttgtgtt
ggtcctaaatcagtcattgaagttagagatggcaacaatttcttggatttagccgtcaga
caaattgaacacttgaacagaaagtatgacgcagacgttccattgttgttaatgaactct
ttcaacactgatgctgacaccgccaaaatcatcaaaaagtaccaaagccacagaattaga
gtgaaaacttttaatcaatccagattcccaagaatttacaaggattctttgcttccagtt
ccagaatcttttgacgactctcttgaagcttggtatccaccaggtcatggtgatttgttt
gaagctttggttcaatctggtgagttagatgccttgttagctcaaggaagagaaatctta
tttgtttctaatggtgataacttgggtgccactgttgactccaagattttagatcacatg
attgaaactggtgctgaatatattatggaattgacccctaaaaccagagctgatgttaaa
gggggtactttaatcaattaccaaggtgaagtaagattattggaaattgctcaagttcca
aaagaacacgttgaagaattcaagagtattaaaaaattcaaatactttaacactaataac
ttgtggatcaacttgagagccatcaagaaattggttgaagcaaatgctattgaagtggaa
atcattccaaatcaaaagaccatttctcatggcaaatcagatatcaatgtgttacaatta
gaaactgccgttggtgccgccatcagacactttaaaggtgcccatggggttgttgttcca
agatccagattcttaccagttaaaacttgttctgatttgttgctagtcaagtctgattta
ttctatttagaacacggtgccttggtgttagatccaactagagatgggttctctaatcca
ttgattaaattgggttcccatttcaagaaagtcagcggattccaatctagaattccttac
attccaaagattttggaattggatcatttgaccattacaggtaatgttacaattggtaaa
ggtgttcaattgaaaggaacagtgattattgtttgtaacgatggtgacaaaattgatatt
ccaaatggtgctatcttagaaaatgttgtggttactggtaacttaactatattggaacat
taa

DBGET integrated database retrieval system