KEGG   Candida dubliniensis: CD36_30600Help
Entry
CD36_30600        CDS       T01140                                 

Definition
ATP:glycerol 3-phosphotransferase, putative (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cdu  Candida dubliniensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CD36_30600
Enzymes [BR:cdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CD36_30600
Exosome [BR:cdu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CD36_30600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R:complement(1117493..1119388)
Genome map
AA seq 631 aa AA seqDB search
MPRRVSNAPCIPVVATIDIGTTSARAIIFSAEGEEIAKHQIEYSTTASEAPENSSNTDQF
RRRSSLLRHDEPIFSAEGIAITLNDNIMIENNKSSVGPTIRFPQPGWVECMPVHILANAV
QCLVACLISLRKVNQDPNLKLKYKVKAIGIANMRETTIVWSRKTGKPLSGGITWTDTRTS
EIIQHLEKMIDEDRKAELKEKTGLPLSTYFSAAKLRWLLDNDDVIREEYEKGDGNLMFGT
VDTWLIYHLTKEKAFVSDITNASRTYFMDLETLDYDDDLLDFWGIDPTKIRLPKIVSSSE
FYGEFAAPKLSNLGFHNKITQEAYDILKTITGVPICGCLGDQSASLVGQLAFSSGSAKCT
YGTGAFLLYNTGPHKLISKRGALTTFGFWFPTLKGNDGKPHYAMEGSIAVAGSIIQWLRD
NLKMIDNAKDIGPLASQVENSGGVVFIPAFSGLYAPYWDGGSRGTIFGMTQYTSAAHIAH
AALEGVCYQVRAILKAMASDAGAVDDFLEDALSCQNTDKLLSTLATDGGMSKADEVLQIQ
ADILGPCVTVKRAQTAECTALGAAIAAGLSFKNEEDRIWKDLDDVVAKISGSSEEMAANS
FTAKLSDENRRKDWKRWEKAVERAKGWLEDE
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtcgtgtcagtaatgcaccatgtatccctgttgtagctacaattgatattggt
actacctcagcaagagctattatattctccgcagaaggggaagaaattgccaagcatcaa
atcgaatattctaccactgcttcagaggcaccagaaaattcctcaaacacagaccaattc
agaagaagatcttcattattaagacacgatgaacccattttctcggctgaaggtattgcc
attaccctcaatgacaatattatgattgaaaataataaatcatctgttggtccaaccata
agatttccacaaccaggttgggttgaatgtatgccagtccatattttggctaatgcagtt
caatgtttggtggcttgtttgatatcattgagaaaagtcaaccaagatccaaatttaaaa
ctcaaatacaaagtcaaagccattggtattgccaatatgagagaaaccaccattgtttgg
tcgagaaaaaccgggaaacctttgagtggtggtatcacttggactgatactagaacttca
gaaattattcaacatttggaaaaaatgattgatgaagatagaaaagccgaactcaaagag
aaaactgggttgcccttatcgacttatttttctgctgccaaattgagatggttattggat
aatgatgatgtcattagagaagaatatgaaaaaggtgatggtaatttaatgtttggtact
gttgatacttggttgatttatcatttaaccaaagaaaaggcatttgtttcggatatcact
aatgcctctcgtacttattttatggatttagaaactttggattatgatgatgacttgtta
gacttttggggcattgatcctacaaaaatcagattacccaaaattgtatcttcttcagaa
ttctatggggaatttgctgcaccaaaattatccaatttgggtttccataataaaatcact
caagaagcttatgatattttgaaaaccattactggggttccaatttgtggatgtctcggt
gatcaatctgcttcgcttgttggtcaattggcattcagttctggttctgccaaatgtact
tatggtactggtgctttccttttatataacactggacctcataaattgattagtaaacgt
ggtgccttgactacttttgggttttggtttccaacattaaagggaaatgatgggaaacct
cattatgccatggaagggtccattgctgttgctgggtcgattattcaatggttgagagat
aacttgaaaatgattgacaatgccaaagatataggtccattggcttcccaagtggaaaat
tccggtggggtggtatttatcccagcattttctggtctctatgcgccatattgggatggt
ggttctaggggtactatatttggtatgacacagtacacatcggctgcacacattgcccat
gctgcattggaaggggtttgttatcaagtaagagctattttgaaagcaatggccagtgat
gctggtgctgtggatgactttttggaagatgcgttatcttgtcaaaacaccgacaagtta
ttatcgacattagctacagatggtggtatgtctaaagccgacgaagttttacaaattcaa
gctgatattttgggtccttgtgttactgtgaaacgtgcacaaactgcagaatgtactgca
ttaggtgctgctattgctgctggattatcatttaagaatgaggaagatcgtatttggaaa
gatttggatgatgtagtggccaaaatcagtggatcaagtgaagagatggccgctaactca
tttactgccaaattatctgatgaaaatagaagaaaagattggaaacgttgggaaaaggct
gtggaaagagccaagggatggttagaagacgaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system