KEGG   Candida dubliniensis: CD36_30910Help
Entry
CD36_30910        CDS       T01140                                 

Definition
TFIIH subunit, putative
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
cdu  Candida dubliniensis
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    CD36_30910
  Replication and repair
   03420 Nucleotide excision repair
    CD36_30910
Transcription machinery [BR:cdu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CD36_30910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R:1169871..1171355
Genome map
AA seq 494 aa AA seqDB search
MSSHLFKATVNEYLEGLPKTVQSKLYEAPATCLSIFRLLSPMAKFYIMSMIFNEKPIALR
DLDKWCKPSARKLEFEALKRLESLHLIEYDSKGSHIRLHSIFRKNFRDCLTGSQNPNAFG
SISTTVDKHKVDIPFLDLFASQKWETILHFMVGTESTATPSDSVLSLLKLGGLMEGPNND
LRITNSGFQFLLQDVNAQIWTLLLQYLNLTQELNMDPVDVLNFIFILGSLELGKSYSVSS
LSETQVSMLADLKDYGLVYQRSDTSGRFYPTRLATTLTSDSAALKTPSMAMDEEEQQVVS
KESIIIETNFKIYAYTKSPLEIAILNLFVHFKTRFANMVCGQITRESIRNALYNGITADQ
IIKFLETHAHPQMRILAKEKLDKKIEFDTSHNINTAGGAPQSKTDGMISQHKLEILPPNV
VDQIKLWQLELDRIQTFDGYLFKDFSNQQEYDILSNYASELGVLIWADKVKKKFFVTKEG
MTQVADFANRKLKR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctcacttatttaaggcaacggttaatgaatacctagaaggactcccgaaaact
gtccaatccaaactatatgaagcaccagctacgtgtttatcgatattccgattgctttct
ccaatggccaaattctatatcatgtcaatgatattcaatgagaaaccaattgcattaaga
gacttggataaatggtgtaaaccactggcgaggaaattggaattcgaagcattaaagaga
ttggaatctttgcatttgatagaatatgatagcaaaggctctcatatcagattgcattct
attttcaggaaaaactttcgtgattgtttgacagggtcacaaaacccaaatgcatttgga
agtataagcaccactgtggataaacataaagtcgatataccatttctagatttgtttgcg
tcacagaaatgggagaccattttgcattttatggtggggaccgaatcaacagcaactcct
tctgattcggttttaagtctacttaaattgggtggattaatggagggccccaataatgat
ttaagaatcacaaatagtgggtttcagtttttgttacaagatgtcaatgcacaaatttgg
acattgttattacaatatttgaatttaacccaggagttgaatatggatccggttgatgtg
ttgaattttatatttatattggggtcattggaattgggtaaaagttattctgtatcaagt
ttgagtgagacccaagtgagtatgttggcagatttaaaggattacgggttggtttatcag
cggtcagatacttctggtagattttacccaacaagattggcaactacattaacttctgat
tcggcagcattgaagacaccatcgatggcgatggatgaggaagaacaacaagttgtaagc
aaggaatcgattatcatagagacaaatttcaagatttatgcatacacaaaatcgccatta
gaaatagccattctaaatttgtttgtacattttaaaaccagatttgccaatatggtatgt
ggtcaaatcacaagagagtctataagaaacgctctatataatggtataactgcagatcag
attatcaagttcttggaaacccatgcacatccccaaatgagaatattagccaaagagaaa
ttggataagaaaattgagtttgataccagtcacaatatcaatactgctggtggtgctcct
caaagtaaaaccgatgggatgatttcacaacataagttggaaatactccctcctaatgtt
gtcgatcaaatcaaactatggcagttagaattagatagaattcaaacgtttgatggatat
ttgttcaaagatttttctaaccagcaagaatatgatatactatccaattatgcttctgaa
ctaggggtattgatttgggccgataaggtgaagaagaagttctttgtcactaaggagggt
atgacccaagttgcagattttgcaaacagaaagttgaaacgttga

DBGET integrated database retrieval system