KEGG   Candida dubliniensis: CD36_31320Help
Entry
CD36_31320        CDS       T01140                                 

Gene name
CEK2
Definition
MAP kinase, putative
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
cdu  Candida dubliniensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R:1230291..1231409
Genome map
AA seq 372 aa AA seqDB search
MKKSTGPTQSRQVVFNISQNFKVLKILGEGAYGIVALAVHLPTETKVAIKKIEPFERPLF
CLRTLREIKLLTKFKNHDNIVRLYDVQKPMNYDSFNEVYLIQEYMPSDLHNIIHTHLLSD
QHVQYFIYQILKGLKMIHSARVIHRDLKPSNILVNERCDLKICDFGLARLDTKHYNFDDT
SRISMLTEYVATRWYRAPEIMLSASNYSTAIDLWSVGCILAELLTYRALFPGSDYINQLK
LIFEVLGTPTDEDLQIIKSDRAQKFIKSLPSKVKINLSDFINNHPCRNIKHRARDPVNPL
AIDLLERLLVFDPAKRITVQEALEHPYLNSYHDQLDEPVTSPIPIKEFEFDIDKKNLDTN
DLKKQIFEMVMS
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatctactggccccacacaatctcgccaagtagttttcaacatatctcaaaac
tttaaagtgctcaagattttgggagaaggtgcttacggtattgttgctttggcagtacat
ttgcccactgaaactaaagtggccatcaagaaaattgaaccatttgaaaggccattattc
tgtcttcgtactttacgagaaatcaaactattaacaaaattcaaaaaccacgataatata
gttcgattatatgatgtacaaaagcccatgaattatgatagctttaatgaagtttatctt
attcaggaatatatgcctctggatttgcataatattatacacactcatcttttgagtgat
caacatgttcaatattttatttatcagattcttaaaggtttgaaaatgatccatagtgca
agagtgatacaccgtgatttgaaaccgtccaatattttagtcaatgaaagatgtgacttg
aagatttgtgattttggattagctcgcttagataccaagcattataattttgatgataca
tctagaatttcaatgctaactgaatacgtcgctacaagatggtatcgagctccagaaatc
atgttgagcgcatccaattattccacagccattgatctttggtcagtgggttgtatatta
gctgaacttttgacttacagagccttgtttcctggctctgactacattaatcaattgaaa
ctaatctttgaagtacttggaacacctactgatgaagacttacagattatcaaatcagac
cgtgcccaaaaatttatcaaatctttaccatcaaaagtcaaaattaacttgagtgacttt
attaataatcatccatgtagaaatattaagcatcgtgctcgagacccagtaaatccacta
gccatagacttattggaaagattattggtttttgatcccgctaaaagaatcaccgttcaa
gaggcattagaacatccttatttaaattcatatcacgatcaacttgatgaacccgtaaca
ctgccaatacctataaaagagtttgaatttgatatagataagaaaaatttggataccaat
gacttgaaaaaacaaattttcgaaatggtaatgtcgtaa

DBGET integrated database retrieval system