KEGG   Candida dubliniensis: CD36_32250Help
Entry
CD36_32250        CDS       T01140                                 

Definition
subunit of histone acetyltransferase complex, putative (EC:2.3.1.48)
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
cdu  Candida dubliniensis
Brite
Enzymes [BR:cdu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CD36_32250
Transcription machinery [BR:cdu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     CD36_32250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R:complement(1421099..1422454)
Genome map
AA seq 451 aa AA seqDB search
MVDRKRTATIRAEDDDEENDNVPLQKKVKIETKQEEEEDGDKKEARDTKSEAKQESKEES
AQKENNEAEEEEDDEEEEEEDEEAEEERKRITNFNFDGEIYTFKERPSVIEEKEGKIEFR
VVNNDNSRENLIVLTGLKNIFQKQLPKMPREYISRLVYDRSHLSMAVVRKPLTVVGGITY
RPFNNRGFAEIVFCAISSTEQVRGYGAHLMNHLKDYVRATSPIKYFLTYADNYAIGYFKK
QGFTKEISLDKSVWMGYIKDYEGGTLMQCSMLPSILRYLDSGKILLLQKAAIERKIRSRS
KSKIVRPGLQVFKTNKNVTLDPKDIPGLAEAGWSEEMDKLAQKPKRGPHYNFMVTLFSEI
QNHPSAWPFAVAVNKEEVPDYYRVIEHPIDLATIEQKLENNLYLKFTDFVDDLKLMFNNC
RAYNSETTTYYKNANKLEKFMNNKLKDCTFV
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacagaaaaagaactgcaacaatacgtgccgaggatgatgatgaagaaaatgac
aatgttcctttacaaaaaaaagtgaaaatagaaacaaaacaagaagaagaggaagatgga
gataagaaggaagccagggacaccaagtctgaggcgaagcaggaatcaaaagaggaatct
gcccagaaggaaaataatgaagcggaagaagaagaggatgatgaagaagaagaagaagaa
gatgaagaagctgaagaagagagaaaaagaataaccaattttaactttgatggcgagatt
tacacatttaaagaacgaccttccgtaattgaagaaaaagaaggaaaaatagaatttcgt
gtggtgaataatgacaatagtagagaaaacttgattgtgttaactggattgaagaatatt
ttccaaaagcaactacccaagatgcctcgtgaatatatatcgcgtttggtgtatgatcga
tcacatttatcaatggctgttgttagaaagcctcttacagtggtaggtggtattacatac
cgtccatttaacaaccgtggatttgccgaaattgtattttgtgctatttcttcaaccgag
caagtgcgtgggtatggtgcacatttgatgaatcatttgaaggactatgtgagggcgaca
tctccaattaagtattttttgacgtatgcagataactatgcaattgggtatttcaaaaaa
cagggtttcacgaaagaaatatcgttagataaatcggtgtggatggggtacataaaggat
tacgaaggtggtacattgatgcagtgttccatgttgccttcaatattgagatacctcgat
ctgggtaaaatattacttttgcaaaaagcagccattgaaaggaaaatcaggtctagatcc
aaatcaaaaatagtgagaccaggcttgcaagtttttaagaccaacaaaaatgtgacttta
gacccaaaagatatccctgggttagcagaggcagggtggctggaagaaatggataagtta
gcgcagaaaccgaaaagaggaccacattacaactttatggttacgctattcagtgaaatt
cagaaccacccttctgcttggccatttgcggtggcagttaacaaagaagaagtaccagat
tactatcgagttatcgaacatccgattgatttagcaacaatagagcaaaaattggagaac
aacttgtatttaaagttcactgattttgtggatgacctaaagctaatgttcaacaattgt
cgagcttataattccgaaaccacaacttattataaaaatgcaaacaagctagagaagttt
atgaataataaattgaaagattgtacttttgtatag

DBGET integrated database retrieval system