KEGG   Candida dubliniensis: CD36_33050Help
Entry
CD36_33050        CDS       T01140                                 

Definition
dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex, putative (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cdu  Candida dubliniensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CD36_33050
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CD36_33050
  Amino acid metabolism
   00310 Lysine degradation
    CD36_33050
Enzymes [BR:cdu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CD36_33050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R:1581218..1582546
Genome map
AA seq 442 aa AA seqDB search
MLSRSIKSSLKRTTTLARPTAAKSALKIANVSSVRSLHIQNTSSYRPTPFLTFQRYASVS
VKVPDMAESITEGTLAAFNKEIGDFVSQDETIATIETDKIDVEVNAPVSGTITEFLVDVD
ATVEVGQEIIKIEEGDAPAGGTAPASEAPAKKEEASEKAKEEPAAAAPPKKEEAKKEEPK
KESKPAPKKEEPKKSAQSTTSAPTFTNFSRNEERVKMNRMRLRIAERLKESQNTAASLTT
FNEVDMSNLMDFRKKYKDEFIEKTGIKLGFMGAFSKASALALKEIPAVNAAIENNDTLVF
KDYADISIAVATPKGLVTPVVRNAESLSILGIEKEISNLGKKARDGKLTLEDMTGGTFTI
SNGGVFGSLYGTPIINMPQTAVLGLHGVKERPVTVNGQIVSRPMMYLALTYDHRVVDGRE
AVIFLRTIKELIEDPRKMLLLE
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgttatcaagatctattaaatcgtcgttaaagcgtactacaactttagccagaccaact
gctgccaagtctgccttgaaaattgccaatgtcagttcagttagatccctccatattcaa
aacacttccagctatagaccaacaccattcttgactttccaaagatatgccagtgtttct
gtcaaagtgccagatatggctgaatccatcacagaaggtactttagccgccttcaacaaa
gagattggtgattttgtcagtcaggacgaaacaattgccaccatcgaaaccgataaaatt
gatgttgaagtcaatgctccagtatcaggtaccatcactgaatttttagttgatgttgat
gccactgttgaagttggtcaagaaatcatcaagatcgaagaaggtgatgccccagctggt
ggtacagcaccagcatctgaagctccagctaagaaagaagaagcttctgaaaaagccaaa
gaagaacctgccgccgccgccccaccaaagaaagaagaagccaagaaagaggaaccaaag
aaagaatcaaaaccagctccaaagaaagaagaacctaagaaatctgcccaatctacaacc
agtgccccaacttttaccaatttctccagaaacgaagagagagttaagatgaacagaatg
agattgagaattgctgaacgtcttaaggaatcacaaaacaccgcagcttctttgaccact
ttcaatgaagttgacatgtcgaatttgatggatttcagaaagaaatacaaggatgaattt
attgaaaagactggtatcaagttaggattcatgggtgccttctccaaagcctctgccttg
gctcttaaggaaatcccagccgtcaatgctgcaattgaaaacaatgacactttggtcttt
aaagattacgccgatatttcgattgctgttgccactccaaagggtttggtgactcctgtg
gtcagaaatgccgaatctttatctatcttgggtattgaaaaggaaatttctaatttgggt
aagaaggccagagatggtaaattgactttggaagatatgactggtggtactttcactatt
tctaatggtggtgtctttggttcattatatggtacgccaattatcaacatgcctcaaact
gccgtattaggattacatggtgttaaagaaagaccagtcactgttaacgggcaaatcgtt
tctagaccaatgatgtacttggcattgacttacgaccacagagtggttgacggtcgtgaa
gctgttattttcttaagaaccatcaaggaattgattgaagacccaagaaagatgttgtta
ttggaataa

DBGET integrated database retrieval system