KEGG   Candida dubliniensis: CD36_33270Help
Entry
CD36_33270        CDS       T01140                                 

Definition
serine/threonine-protein phosphatase, putative (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
cdu  Candida dubliniensis
Pathway
mRNA surveillance pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    CD36_33270
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    CD36_33270
Enzymes [BR:cdu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     CD36_33270
Protein phosphatases and associated proteins [BR:cdu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     CD36_33270
Transcription machinery [BR:cdu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     CD36_33270
Spliceosome [BR:cdu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    CD36_33270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R:1633811..1634803
Genome map
AA seq 330 aa AA seqDB search
MSNNIDDDSISVDNIVDRLLEVRGSRPGKQVTLTENEIRFLCTKAREIFIQQPILLELEA
PIKICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPEN
FFILRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLS
PDLNSMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQ
KHDMDLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILK
PADKKPRYAPANVANNRPGANQRKPKKTVK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacaacatcgacgacgattccatctctgttgacaatattgtcgaccgtcttttg
gaggtgagaggatcgagacctggaaaacaagttacattaaccgaaaatgagattagattc
ctttgtactaaagcccgtgaaattttcatccagcaacctattcttttagaattagaagca
ccaatcaagatttgtggtgatatccacggacagtattacgatctactccgtttattcgaa
tatggtggcttcccccctgaggccaattatttatttttgggggactacgttgatcgtggt
aaacaatcattagaaacaatttgccttttacttgcctacaagatcaaatatccagaaaac
tttttcattcttcgtggtaaccatgaatgtgccagtatcaaccgtatctatggattttac
gatgaatgtaaaagaagattcaacataaagttatggaagacattcacagattgttttaat
tgtcttccaattgctgccataattgacgaaaaaattttcacaatgcatggaggtttgtct
ccagacttgaactctatggaacaaatcagaagagtgatgagaccaaccgatattcctgat
gtcgggttgttgtgtgatttattatggtcagaccccgataaggatatcactggatggtca
gaaaatgaccgtggtgtgtcgttcacttttggaccggatgttgtgtctcgatttttacaa
aagcatgatatggacttgatctgtcgtgcccatcaagttgttgaagacggatacgagttt
ttcagcaaacgacaattggtgacattgttttcggcaccaaactattgtggtgaattcgat
aatgctggtgccatgatgtcagttgatgaaagtttgttatgttcattccaaattttgaaa
ccagcagacaagaaaccaagatacgccccagcaaatgtggcaaacaaccgaccaggagcc
aatcaaagaaaaccaaagaagactgtgaaataa

DBGET integrated database retrieval system