KEGG   Candida dubliniensis: CD36_33890Help
Entry
CD36_33890        CDS       T01140                                 

Definition
patatin-like serine hydrolase, putative
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
cdu  Candida dubliniensis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CD36_33890
Enzymes [BR:cdu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CD36_33890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R:complement(1769386..1773540)
Genome map
AA seq 1384 aa AA seqDB search
MGPEFEDSIPLEHPDNRTTSIYSVYTMIGDILSFVQWLLFKVLNLIIIDSPAFVLRLLSK
NFEINLHLSSILVTLVGVSVVAYLVIRYKFLTGYSQSNDQKEGASKKSSHPASSKVFVGK
SKQDKKPGNYLDEFLLAIKVFGYLDKAVFHELTKSMTTQKLSQEEILCLDESLGFSIVVE
GVAQVYTKKSKEKSSKYKHHHFEEIEEERDEFLILGDKQYQLLNEVKSGAPLSSLFSTLD
LFRPRNTNEEMALTPSDEDGNSVVALNMDYLGKSVPDSKLNSSDEDENSEDYPEIIVRPK
KSHNNGTMTIAIIPHTAFERVQSKYPKATSHIVTMVLTRLYKVTMSTVQNYLGLTSEILK
SEIKLNEENAMSLPRYFVDGLLQRLNKTKESEAETENLPKKLKHHHRNPLQRTTSRYVSL
DSKVKSNHPGDLLSSVPISRSEFQKKNVPKSSATSLSDGDNKRMNFTDEMEETEENSLRV
AIIENIFKMVGIEETNGIDERSGYFQSLSSSTSSSIVGLDSLNQSIMSGTTTPTTKRSHP
VFNNRGSLMNTINLAELRKPSTSENSTLPKFSAKKRLLSDMNIKDAFAKSLEIKYIGPDC
TIVSQNSAVTGLYYVIDGSLEIYNRSADVSAPNRYIYTVESGGIAGYLTSVVGFRSMVTI
KTPKKTGAVVAYIAKNDYNKLLDKYYFLQLPVALKLKNLLSKQILTIDYALEWCHIPAGE
VLCSQGDLANGFHVVLSGRFRVVRSTNKNTEKEDVEVLGEYGHGESIGEVEVLTASRRSN
TLIAVRDSETARIPRSLFEMLSNENPSIMVSVSRLVASKVLASQYQPRERNFITSTTSQE
SFTSANYKTITILPTVSGLPVRQFAEKLVQALRQIGRNVIALDQASILTHLGRHAFDESL
ARLKLSGYFAYLEEEYETIVYICDTPVQSNWTSTCISQGDCILLLADAEDDSTTIGEYEQ
LLVKLKTTARTDLCLLHRDKVVRPGSTSPWLKNRIWVQGHHHIQMKFEQEENVLPHKKSF
ISDLAARISQNKAIKSTFEATKQHIKWYIKENDQSKVLKIYKDDFMRLARILSNEAVGLV
LGGGGSRGISHVGVVTSLERHGIPVDIIGGTSIGSFVGGLYAKEYNIVSIYAMAKKFSKR
ISSIWRMLFDLTYPVTSYITGYEFNRGIWKVFGFAEIEDFWIKYFCNSANITNSTMDIHE
TGHAWRFIRASMSLAGLLPPIAFNGCMLLDGGYLDNLPVNEMKKRGVKHIIAVDVGSVDD
RTPMNYGDTLSGFWVLLNRWNPFSSHPNIPTMMDIQMRLTYVSSVNALEEAKRTPGVYYL
RPPIDPYATLDFGKFDEIYKVGLKYADDLFVEWKSNGKFPRIAGLVEKKKDGEEKRIFYR
RNSI
NT seq 4155 nt NT seq  +upstreamnt  +downstreamnt
atgggcccggagtttgaggatctgataccgttggagcatccagacaatagaactaccagt
atatacctggtatatacaatgataggtgacattttgctgtttgttcaatggctattattc
aaagtgttgaatctcataattattgattctccagcattcgttctacgacttctttcaaaa
aattttgaaataaacttgcatttatcttctattttggtgacactagttggtgttagtgtt
gtggcttatttggttatcaggtataaatttcttacaggatattcccaaagcaacgatcaa
aaagaaggggcgagtaagaagagcagtcatcccgcttcctcgaaagtatttgttggaaaa
tcaaagcaagataaaaaaccaggcaattatttagatgagtttttactagcaattaaagtt
tttgggtacttggacaaagctgtgttccatgaattgacaaaaagtatgactacacagaaa
ttgtcgcaagaggagatattgtgtttggatgaatcattggggtttctgatagtcgtcgaa
ggggttgcccaagtatatacaaaaaagtctaaggagaaactgctgaaatataagcatcac
cattttgaggagattgaagaggagcgggatgagtttttgattcttggtgacaagcagtac
caacttttgaatgaagtcaaaagtggtgctccattgagttcgttgttctccaccttagac
ttgtttaggccaaggaatactaatgaggaaatggctttgactccgagcgatgaagatggg
aacagtgttgttgcattgaatatggattatttgggtaaatcagtacctgattcaaaattg
aacagcagcgacgaagacgaaaatagtgaggattatcctgaaataattgtcagaccaaaa
aagtcacataataacggtaccatgactatagcaattatcccccacactgcattcgaacgc
gtccaactgaagtatccaaaggccacatctcacattgtcacaatggttttaactaggttg
tacaaagtgacaatgagcactgtgcaaaattaccttggtttaaccagtgagattttgaaa
ctggagataaagttgaacgaagaaaacgctatgagcttgcccagatactttgttgacggt
ttattgcaaaggttgaacaagacgaaagaatccgaggctgagaccgagaacttaccaaag
aagcttaagcatcatcatagaaacccgttacaaagaactacttcgaggtatgtgtctttg
gattctaaagtgaaaagtaatcatccgggtgatttgctttcgtcggtgcctatttctcga
agtgagttccaaaaaaagaatgtcccaaaatcttcagctacttcattgctggatggagat
aacaaaagaatgaacttcactgatgaaatggaagaaactgaggagaactctttacgagtt
gcgataatcgagaatattttcaaaatggttggtatcgaagagacaaatggtatagatgaa
agaagtggatatttccaaagcttgagctcttcaacaagcagctctattgtgggcttggat
agtttgaatcagtcgattatgtccggtactaccactccaaccactaaaagatcacatccg
gtattcaacaatcgtggaagcttaatgaacacgattaatctagcagaattgagaaaacca
tcgacttctgaaaactcgacattgcctaaattttctgccaagaagcgtttgttatcagac
atgaatatcaaagatgcatttgctaaatctctagagatcaagtacattggtcccgattgt
acgatcgtgagtcagaattcagctgttactgggttgtactacgttatagatgggtctttg
gaaatttacaatcgttctgcagatgtttctgcccctaatagatacatctatacagtcgag
tctggtgggattgctggatatttgacttcggttgttgggttcagatcgatggtgacgata
aagacccccaaaaaaacaggggcagttgttgcgtacatagctaagaatgactacaataag
ttgttagacaagtattactttttgcagttacccgttgcacttaaattaaaaaatttgcta
tccaagcagatactcacgattgattatgcgctagaatggtgtcacatacctgcaggtgaa
gttttgtgctcacagggagacttggccaatgggttccatgttgtcttgagtgggaggttt
agggttgttaggtcaacaaacaaaaataccgaaaaggaggacgttgaggttttgggcgaa
tatgggcatggtgaatctattggtgaagtcgaagtgttgacggcttcgagaagatcaaac
acattgattgcagttcgagattcagaaacagcacgtatcccaagatcattatttgaaatg
ttgtctaatgagaatccatcaataatggttagtgtttctcgtttagttgcatccaaagta
cttgctctgcagtatcaaccaagagagcggaattttatcacttcaactacttcgcaagag
tcgttcacatccgcaaattataaaacaataacaattttgcccaccgtgtctggtttaccg
gtgcgacaatttgcagaaaagttggttcaggctttaagacagattggccgaaacgtgatt
gcattagaccaggctctgatcttgactcatttggggagacatgcgtttgatgaaagtttg
gcaaggttgaaactactggggtattttgcgtatttggaagaagaatacgagaccattgta
tacatttgcgacaccccagttcagtctaattggacgtcaacctgtatctctcaaggtgac
tgtattttgttattagcagatgccgaggatgatagcacgactattggtgagtatgagcaa
ctcttggttaaattgaaaactacagctagaacagatttgtgtttgcttcatagggacaaa
gttgttagaccagggtctactagtccgtggttgaaaaatagaatttgggttcaaggacat
caccatattcaaatgaagtttgagcaagaggaaaatgttttaccacacaaaaaatcgttt
ataagcgatttggcggctagaatttctcagaataaggcaataaagtcaacttttgaggca
acaaagcagcacatcaaatggtatatcaaagaaaacgaccagagcaaggtgttgaaaatt
tacaaggatgactttatgcgattagcgcggattctttccaatgaagcagtaggtcttgtt
ttgggaggtggtggttcaagaggtatatctcacgttggtgttgtcactagtttagagcga
catggaattccggttgacattattgggggtacatccattgggtcttttgttggtgggttg
tatgccaaggagtacaacattgtctccatttatgccatggcgaaaaagttttcgaaaaga
atatcttcgatttggcgaatgttgtttgatttaacctacccagtcacttcctacatcaca
ggttatgaattcaatcgtggtatttggaaggttttcggttttgccgaaattgaggatttt
tggattaaatatttttgtaactcggcaaatatcactaactcaactatggacatccacgaa
acgggacacgcgtggagatttatccgtgcatcaatgtcgcttgcaggtcttttaccccct
atcgccttcaacggatgcatgttacttgatggtggctatttggataacttgcctgtgaat
gagatgaagaaaagaggtgtcaagcacattattgctgttgatgttggttctgttgatgac
cgtaccccaatgaactatggtgacactctcctggggttctgggttttgcttaatcgttgg
aaccctttttccagccaccccaacattccaacaatgatggatattcaaatgagattgacc
tatgtttctagtgtcaatgcattggaggaggccaagagaactcccggtgtttattattta
cggccacctatcgatccttatgccactttagattttggaaagtttgatgagatttacaag
gttggattaaagtatgcagacgacttgttcgttgagtggaaaagcaacggcaaatttcca
agaatcgccggattggttgagaaaaaaaaggatggagaagaaaagagaatattttatcga
agaaactctatctag

DBGET integrated database retrieval system