KEGG   Candida dubliniensis: CD36_34370Help
Entry
CD36_34370        CDS       T01140                                 

Definition
[pyruvate dehydrogenase [lipoamide]] kinase, mitochondrial precursor, putative (EC:2.7.11.2)
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
cdu  Candida dubliniensis
Brite
Enzymes [BR:cdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     CD36_34370
Protein kinases [BR:cdu01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   CD36_34370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R:1878434..1879969
Genome map
AA seq 511 aa AA seqDB search
MGTAWELTQALKDQIFKYASFNQTPVSLRQMVQFGPVPSPGSIFLASRFIVEELPIRLAK
KVKDLENAPLGLNEMPSTIQVKNWYAQSFQELTELHKPKISDELAKLLSKGASKHSLPED
SITEKPHVKQEIHRIPDSLDDNPAINNIFSDDGIVVRHHHHHHSISRARPRLSDNTQTRV
ESPTYGMSYFSPCQGNIVWPKEVYDYNKLVRETLEVIKKRHDATVATMAQGVQEWKTKNQ
TVMVNSQIQTFLDRFYMSRIGIRMLIGQHIALNMAQNSPTKQRLSSLINGSQGTTKKPRS
NYVGVICTDCNVGEIAEDAIETAKYICEEYYGLFEAPEIQLIAPQQDINFMYVPGHLIHM
LFETLKNSLRATIEFHTPKLKQKMIDEDPNLKFDEIDINDLKFPPIKVIISEGTEDIAIK
ISDEGGGIPRSSLPLIWTYLYTTVDETPKLEPEYDQTSFKAPMAGFGYGLPISRLYAQYF
GGDLKLISMEGYGTDVYLHLNRLSSSNEPLP
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgggtacagcttgggaattaacacaagctctcaaggatcaaatattcaaatatgcttct
ttcaaccaaaccccggtttccttgagacagatggtccaatttggaccggttccttcccca
ggttcaattttcttagcatcaagatttatcgttgaagagttaccaatccgattggctaaa
aaagtgaaagatttggagaatgccccattaggattgaatgaaatgccatcaacaattcag
gtgaaaaattggtatgcccaatccttccaagaattaacggaattacataaaccaaagata
agcgacgagttggcaaagcttttatccaaaggtgccagtaaacattctctaccagaggac
tcgataactgaaaaaccacatgtcaaacaagagatacatcgtatacccgatctgctagat
gacaacccggcaatcaataatatttttagcgacgatgggattgttgtccgacatcaccac
catcaccattccatttccagagcaagaccccgtttaagtgataacacccaaacaagagtt
gaatcaccaacttatggcatgtcgtattttagtccgtgtcagggaaacattgtgtggcca
aaagaagtttatgattacaacaaattggttcgtgaaacattggaagtaattaaaaaaaga
cacgatgctacagtggcaaccatggcccaaggagttcaagaatggaaaactaaaaatcaa
actgtgatggtcaattctcaaatccagacgtttttagatcggttttatatgtcgagaatt
ggtataagaatgttgattggtcaacatattgctttaaatatggcccagaattcacctaca
aagcagagattaagttcattgattaacgggtctcaaggaaccaccaagaagcctcgttca
aattatgttggtgtcatatgtactgattgcaatgttggggaaattgctgaagatgctatt
gaaactgccaagtacatttgtgaagaatattatgggttatttgaagccccagaaatacag
ttgattgcacctcaacaagacataaattttatgtatgttcctggacacttgattcacatg
ctttttgaaactttgaagaactctttgagagctaccatcgagttccacacaccaaagttg
aaacaaaagatgatagacgaagatccaaatttgaaatttgacgaaatcgatataaatgat
ttgaaatttccacctataaaagtaattatcctggaaggtaccgaagacattgcaataaaa
atttctgatgagggtggtggtatacctaggtcatcattgccgttgatttggacgtatttg
tacacaaccgtggatgaaacaccaaaattagaaccagaatatgatcaaacctcattcaaa
gcaccaatggctggttttggttacggtttacccattagtagattatatgcacaatatttt
ggtggtgatttgaagttgatttccatggaaggctatggaactgatgtttacttgcatttg
aatagattgagtagttctaatgaaccgctcccatga

  All links  
No link information was found.   
DBGET integrated database retrieval system