KEGG   Candida dubliniensis: CD36_34440Help
Entry
CD36_34440        CDS       T01140                                 

Definition
serine/threonine-protein kinase, putative (EC:2.7.12.2)
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
cdu  Candida dubliniensis
Pathway
Cell cycle - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:cdu04111]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R:complement(1892740..1894809)
Genome map
AA seq 689 aa AA seqDB search
MMPHDSLSHVATSFSSHRSSPSSNSSTKRRLALEDDPTVLPPALSSYSIQCLNERTKTST
LPSQITGKYELDFPDSNNKRDNTLRNKLAAHFTNESTRSREISNSFTNLSEDRSSINTAP
TTTPGSKTFEDLRSKRKRRFGKSLGPPKRGIDIAQESTPVGDKSSSENESKSNLTPQLKP
LNEIKPKAPSLERFSPLLKRNHKSIETDDTITKRIEARRREQMEQEFVKKEKENELAEME
IKKLEQVAVLQSPFEELKFNEFQEPKQSRVPLREIPVNSADVFRKPKAPKSVVSPSPNVQ
SNPIIPPTKPVFRNTSQDFPQPPQQLQHNQKHQQALPSAPIPPKVHYDRPQHSGNKRALI
INGKSYEKLELIGKGGSSKVYRVRSLNNNCVYALKKVELGQFEDVSGFKGEIDLLTKLKS
CERVVTLVDYATTESSLYLIMEKGDLDLAEVLQYRLKLDAPLDLNFVKYHTIEIFKCIKD
VHDAGIVHSDLKPANFLFVRGMLKIIDFGIANAVPDHTINVYRENQIGTPNYMAPEAICE
SNYTSARIWKVGKPSDIWSIGCILYQFIYGKAPFAGYSGNQKLMAITNPHIKISFPSSGI
GNTPVPLSAIELMKNCLHRDPNDRWTIEQCLACDFLSPKIVSENFIREVVHQSINYGYNS
RISGDGMTSDRYDALVDSVMKQIQNLNYS
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgatgccacatgattcactatcacatgtggcgacaagtttttccctgcatcggtcgtca
ccatcaagcaacagttcaaccaaacgacgtttagcattagaggatgacccaacagttcta
cccccggcattaagctcatatagtatacagtgtttaaatgaaagaaccaaaacatccaca
cttccatctcaaataacaggaaagtatgaactagatttcccggactcgaataataaaaga
gacaatactttacgaaacaaattagctgcacattttacaaacgaatcaactagatctcgt
gaaatatctaattcattcacaaacttatctgaagacagatcaagcataaatactgcgcca
acaacaaccccaggcagcaaaacatttgaagacttgcgcagtaaacggaaaagaaggttt
ggtaagctgttgggaccacctaaaagaggtattgatatcgctcaagaaagcacaccagtt
ggagataaactgtcctctgagaatgaaagcaagtctaacctcacaccgcaactcaaaccg
ttgaatgaaataaagccgaaggcaccatcattagaaagattctcccctcttttgaaaagg
aaccataaatccatcgagactgacgataccattacaaaacgaatcgaagcaagaagacga
gaacagatggaacaagagtttgtgaaaaaagaaaaggaaaacgaattggcagaaatggaa
ataaaaaaacttgaacaagtagcagtactacagtctcctttcgaagaacttaagtttaat
gaattccaagaacccaaacaaagtcgtgtaccactacgtgaaatacctgtcaatagtgct
gatgtttttcgaaagccaaaagctccaaaatctgttgtatctccttctcctaatgtacaa
agcaaccccattataccacctacgaaaccagtttttagaaataccctgcaagactttcca
caacctcctcaacaacttcaacataatcaaaaacatcaacaggcattaccctctgcacct
ataccacccaaagttcattacgatagaccccaacattccggaaataaacgagcattgata
ataaatggcaagctgtacgaaaaattggaacttataggaaaaggaggatcatccaaagta
taccgagtaagatcactcaataacaattgtgtttatgccctcaaaaaagttgaacttgga
caatttgaagatgtgagtggatttaaaggagaaattgatttacttaccaagttaaagtca
tgcgaaagagtagtgactttagttgattacgccaccactgaaagctcgctttatcttata
atggagaaaggtgatcttgacttggctgaagttcttcaatataggttgaaattggatgct
cctttggatttgaactttgtcaaatatcacaccattgaaatttttaaatgcataaaagat
gttcacgatgctggcattgtacacagtgatttgaaaccggcgaattttttgtttgtcagg
ggcatgttaaaaattatagactttggtattgcaaatgctgtacctgaccacaccataaat
gtttaccgagagaaccagattggtacacccaattacatggcgccagaagccatatgcgaa
tcaaattatacctcagcaagaatttggaaggtaggcaaaccttctgatatttggtcgatc
gggtgtattttgtatcaattcatatatgggaaagcaccttttgctggctattctggcaac
cagaaattgatggctataacaaatccgcatataaagatttcgtttccgagcagtggcatt
ggcaatactccggtgcctcttagtgctatcgaattgatgaaaaattgtttacaccgtgac
ccaaacgatagatggacaatagagcaatgtctagcctgtgattttctactgccgaaaata
gttagtgagaattttattcgtgaagttgttcaccaatctatcaactatggctataacagt
agaatctcgggtgacggtatgacaagtgatagatatgatgctttggtggactctgtaatg
aaacaaatacaaaacttaaactacagctag

DBGET integrated database retrieval system