KEGG   Candida dubliniensis: CD36_34525Help
Entry
CD36_34525        CDS       T01140                                 

Definition
oxidoreductase, putative (EC:1.-.-.-)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cdu  Candida dubliniensis
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cdu00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R:complement(1915909..1916766)
Genome map
AA seq 285 aa AA seqDB search
MEDKRELLKQPIHGIYIPIGLILFGTWIFGWEYMPYSIGFIVVIVSIQYYAALRRASSMH
HIKWQEFELLDKTLIAPMTSIYRFKLRREDEVLYIPTGHSLACCFNIDGKDEVRYYTPIS
NQFDKGFFDILVKHYEHGVVTRKLANLQVGQTAQFRGPFGKLQYVPNSAKELALVAGGTG
ITPMLQVITAIITNLEDNTKIKLLFANNTEKDILLKDELDSMAQKYPGLEIKYVTGKFVD
KESFEFLPSPSSDAKVFICGPPAFVEYINEMTKDAGFEKDQVFCF
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggaggataaaagagaattacttaaacaaccaattcatggtatatatattcctataggg
ttaatcttgtttggtacatggatctttggttgggagtatatgccgtattcaataggattt
attgttgttatagtgtctatacaatattatgctgccttgagacgtgcttcatccatgcat
catattaaatggcaagagtttgaattgttggataagacattaattgctcccatgacatcg
atttatcgtttcaaattaagaagagaagatgaagtgttatacattcctactggacattct
ttagcttgctgttttaatattgatgggaaagatgaggttagatattatactccgatttct
aatcaatttgataaagggtttttcgatattttggttaaacattatgaacacggtgttgtc
acgagaaaattggctaatcttcaagttggacagacagctcagttcaggggaccatttggg
aaattgcagtatgtgccaaatctggctaaagagttggctttagttgcaggaggcactggt
attaccccaatgttacaagtgattactgccatcatcactaatcttgaagataataccaag
attaaattgttatttgccaataacaccgaaaaagatatattattaaaagatgaattggat
agtatggcacaaaagtatccaggtttggaaattaaatatgtcacgggaaaatttgtcgat
aaagaactgtttgaatttttgccttcaccaagttctgatgcaaaagtatttatttgtggt
cccccagcatttgttgaatatatcaatgaaatgactaaagatgctggatttgaaaaagat
caagtgttctgcttttaa

DBGET integrated database retrieval system