KEGG   Candida dubliniensis: CD36_35285Help
Entry
CD36_35285        CDS       T01140                                 

Definition
eukaryotic translation initiation factor, putative
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
cdu  Candida dubliniensis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CD36_35285
Translation factors [BR:cdu03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    CD36_35285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R:2184102..2184953
Genome map
AA seq 283 aa AA seqDB search
MSWDDEDFDIPSNNKKTVSASWEDEEEDDPVLESWDIDPEEEEKKKKEAKLQEAKRKAEL
KAKEDAEKAKKAAKRKELEQFDQLDERTRKELLKKAELNADLNNAADLFGGLGVANDDDG
DDFDINEHPRERITKQQLAAAASKRPALTKDTPLEEHPLFQPTNKQEYEKLRKTVGTSLT
RLNEDSSLLYASSLAVDLIRDLSQPLSVENLRKVISTLNVVIKEKERQERQARLKKAGGT
ATGGAGKKKAKPLARPNVGGFKKDAFDDMDDGQFDDLDDDDFM
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgagttgggacgacgaagattttgatattccatcgaataataaaaaaaccgttagtgca
tcttgggaagacgaagaagaagatgatccagttttggaatcatgggatatcgatcctgaa
gaagaagaaaagaagaaaaaggaggcaaaattacaagaggctaaaagaaaagctgaacta
aaagccaaagaggatgcagaaaaggcgaaaaaagctgccaaaagaaaagaattagaacaa
tttgatcaattggatgaaagaactcgtaaagaattattgaagaaagctgaattaaatgcc
gatttgaataatgctgctgatttgtttggagggttgggtgttgccaacgatgatgatggt
gatgattttgatattaatgagcatccaagagaaagaataactaaacaacaattagctgct
gcagctagtaaaagaccagcattaaccaaagatacacctttggaagaacatccattgttc
caacctacaaacaaacaagaatatgaaaagttaagaaagaccgttggtacctcattgaca
agattgaatgaagattcttctttattgtatgcatctagtttggccgttgatttgataaga
gacttgtcacaaccattatcagtggaaaaccttaggaaagttatcagcaccttgaatgtg
gtgattaaggagaaagaaagacaggaaagacaagcaagattaaagaaagctggtggtact
gctactggtggggccggtaaaaagaaagctaaaccactcgccagaccaaatgtaggtggg
ttcaagaaggatgcatttgatgatatggatgatggtcaatttgatgatttagatgatgat
gattttatgtaa

DBGET integrated database retrieval system