KEGG   Candida dubliniensis: CD36_35334Help
Entry
CD36_35334        CDS       T01140                                 

Definition
(RefSeq) eukaryotic translation initiation factor 4e, putative
  KO
K03259  
translation initiation factor 4E
Organism
cdu  Candida dubliniensis
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CD36_35334
Messenger RNA biogenesis [BR:cdu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     CD36_35334
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     CD36_35334
Translation factors [BR:cdu03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    CD36_35334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R:2200034..2200663
Genome map
AA seq 209 aa AA seqDB search
MSEELAQKTEGLSLDSKTVFDSKEEFNAKHPLNSRWTLWYTKPQTNKSENWHDLLKPVIT
FSSVEEFWGIYNSIPPANQLPLKSDYHLFKEGIRPEWEDEANSKGGKWQFSFNKKSEVNP
IINDLWLRGLLAVIGETIEDEENEVNGIVLNIRKQAYRVGIWTKDCDESKLKIVGERLKK
VLQLTDEQKVEFMSHDASNTRGAEPQIVL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagaattagctcaaaaaacagaaggattgtcgttggattccaagactgttttc
gactccaaagaagaatttaatgcaaagcatccattgaacagtagatggacattatggtac
actaaaccacaaacaaataagagtgaaaactggcacgatttgttaaagccagtcataacc
ttctcgtcagttgaagaattttgggggatttacaactcgattccaccagcaaatcaatta
ccattgaagtcagactaccatttgtttaaagaaggaattagaccagaatgggaagatgag
gctaactccaagggtggtaaatggcagttttctttcaacaagaaactggaagtcaatcca
atcataaatgatttgtggttaagagggttgttggcagttattggtgaaaccattgaggat
gaagaaaatgaagttaatggtattgtgttgaacatcagaaaacaagcttacagggttggt
atttggaccaaagattgtgatgaatcgaaattgaagattgttggcgagagattgaagaaa
gtcttgcaattaaccgacgaacaaaaagttgaattcatgtcgcatgatgcctccaatact
agaggtgctgaacctcaaattgttttgtaa

DBGET integrated database retrieval system