KEGG   Candida dubliniensis: CD36_35334Help
Entry
CD36_35334        CDS       T01140                                 

Definition
eukaryotic translation initiation factor 4e, putative
Orthology
K03259  
translation initiation factor 4E
Organism
cdu  Candida dubliniensis
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CD36_35334
Translation factors [BR:cdu03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    CD36_35334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R:2200034..2200663
Genome map
AA seq 209 aa AA seqDB search
MSEELAQKTEGLSLDSKTVFDSKEEFNAKHPLNSRWTLWYTKPQTNKSENWHDLLKPVIT
FSSVEEFWGIYNSIPPANQLPLKSDYHLFKEGIRPEWEDEANSKGGKWQFSFNKKSEVNP
IINDLWLRGLLAVIGETIEDEENEVNGIVLNIRKQAYRVGIWTKDCDESKLKIVGERLKK
VLQLTDEQKVEFMSHDASNTRGAEPQIVL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagaattagctcaaaaaacagaaggattgtcgttggattccaagactgttttc
gactccaaagaagaatttaatgcaaagcatccattgaacagtagatggacattatggtac
actaaaccacaaacaaataagagtgaaaactggcacgatttgttaaagccagtcataacc
ttctcgtcagttgaagaattttgggggatttacaactcgattccaccagcaaatcaatta
ccattgaagtcagactaccatttgtttaaagaaggaattagaccagaatgggaagatgag
gctaactccaagggtggtaaatggcagttttctttcaacaagaaactggaagtcaatcca
atcataaatgatttgtggttaagagggttgttggcagttattggtgaaaccattgaggat
gaagaaaatgaagttaatggtattgtgttgaacatcagaaaacaagcttacagggttggt
atttggaccaaagattgtgatgaatcgaaattgaagattgttggcgagagattgaagaaa
gtcttgcaattaaccgacgaacaaaaagttgaattcatgtcgcatgatgcctccaatact
agaggtgctgaacctcaaattgttttgtaa

DBGET integrated database retrieval system