KEGG   Candida dubliniensis: CD36_35390Help
Entry
CD36_35390        CDS       T01140                                 

Definition
gamma-glutamyl kinase, putative (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cdu  Candida dubliniensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CD36_35390
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CD36_35390
Enzymes [BR:cdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     CD36_35390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R:2212454..2213716
Genome map
AA seq 420 aa AA seqDB search
MTKQFTIVVKLGTSSLVDEVTREPRIANMSLIVEAMVKLRRQGHKIVIVSSGAIACGMKQ
VGLQDKPANLSAVQALASIGQVRLIRTFDDLFRQLEQPIAQILLTRNDIMDFTQYKNAQN
TLNELMDMGIIPIVNENDTLSVSEIKFGDNDSLSAITAGIIHADYLFLMTDVECLYTDNP
RTNPQAQPILVVDKIDDLHVKTDTESGAGSKVGTGGMTTKLIAADLATNAGVTTIITLSS
QPYYILDIVAHIQAHADTLSVEDQRLALQRDIQQGKIPLHTRFLSKPQDTLIKSDRRFWL
LHGLKTKGALVIDQGCFQALTRRNRAGLLPVGILHVVGNFHQSECVSIKVVPDKNGAIED
AVEVGHCRVNYSAPEIILIKGHKSSEIESILGYADSEYVAHRDNLAFPPVMPPSTESLIG
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacagttcaccatagttgtcaaacttggaacgtcgtctctcgtggacgaggtt
actagagaaccaagaattgccaacatgtcgctcatagtcgaagcaatggtcaaactacgc
cgccagggccacaagatcgtcattgtctcgtccggggcaattgcttgtggaatgaaacag
gtgggactacaagacaaacctgccaacctatcagcagtgcaggcattggcgtctatagga
caagtgcgtcttatcagaacctttgacgatctattccgacaattggaacaacctatagcc
cagattttactcacaagaaacgatatcatggattttacccaatacaaaaacgcccagaat
accttgaatgagttgatggatatgggcattatcccaatagtcaacgaaaacgatacattg
tcagtttccgaaatcaagtttggcgataacgatagtttgtcagcaatcacagccggaatc
atccacgccgactacttgtttctcatgaccgacgttgagtgtttgtacaccgacaaccca
agaactaacccacaggcacaacctattttggtggtagataagatcgacgacttgcatgta
aaaacagacaccgaatctggtgctgggtctaaggtcggaactggcgggatgacaaccaaa
ctaattgcagctgatttggcaacaaacgccggcgtcaccaccatcatcacattgtcgagc
cagccctactacattctcgatattgtcgcccacatccaagcacatgcagacacattgtcg
gttgaagaccagcgtcttgccctacaaagagacatccagcaaggcaaaattccgttgcat
accagattcctaagcaagcctcaagatacactaatcaagtcggatcgcagattctggttg
ctacatggattaaagacgaaaggtgcgttggttattgaccaagggtgtttccaggcattg
acacgtcgtaaccgtgcaggattgttgccagtcggcatcctacatgtggtcgggaatttt
caccaaagcgagtgtgtttccatcaaagttgtccccgacaagaacggcgctattgaagac
gcagtcgaagtgggccactgcagagtcaattacctggcaccagaaattatactaatcaaa
ggtcacaaaagtagtgagattgaatctatcttgggttatgccgacagtgagtacgtagct
catagagataatttggcattcccaccagtcatgcctccttcaactgaatccttgatcggg
tag

DBGET integrated database retrieval system