KEGG   Candida dubliniensis: CD36_40210Help
Entry
CD36_40210        CDS       T01140                                 

Gene name
HIS4
Definition
histidine biosynthesis trifunctional protein [includes: phosphoribosyl-amp cyclohydrolase ; phosphoribosyl-atp pyrophosphohydrolase ; histidinol dehydrogenase (hdh)], putative
Orthology
K14152  
phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase / histidinol dehydrogenase [EC:3.6.1.31 3.5.4.19 1.1.1.23]
Organism
cdu  Candida dubliniensis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cdu01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:cdu00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(29808..32315)
Genome map
AA seq 835 aa AA seqDB search
MTFPVLPVISSPEDRESINEFSLVGQVIFPIESVSIKKHFIHQFPHDVDIFVNAIDNASI
DQIVELLNVGIKQVFVNETQYREAIEAGLPSARFVVSVDVPSAELVASEASFVVTKPFPE
GNLKEYNANENRVLYIKSDFTQDEAIELAKNYIPVIPSSKLSVKREEKNKISISAVFVST
LTTDRPDGLYTTLITTPSPSYTALGIVYSSKDSIVAAIEEKVGVYQSRKRRDELWYKGKT
SGATQKLVKLSKDCDSDVIQFMVEPRTGYGFCHRETKFTCFGDDMADSPARGLPKLDSTL
QDRLENAPEGSYTKRLFDDEKLLIAKLKEELDELIEAKSKEEIAWECADLVYFAMVWCIK
HGVRLADVEKNLDVKSLKVSRRKGDAKPKYQEPTTNSSYKLEIVSIDDAAAVERAMTRPV
QKTADIMKLVLPIIEKVKSDGDKALIELTSKFDGVKLDTPVLQAPFPAESMDISEEMKAA
IDLSMQNIEKFHAAQLPKEKVMTVETCPGVFCSRFAKPIENVGLYVPGGTAVLPSTAMML
GVPAKVAGCKNIIIASPPSRATGKLTPEVVYVAHKLGAKCIVMAGGAQAVTAMAYGTESV
LKCDKILGPGNQFVTAAKMYVQNDTQALCSIDMPAGPSEVLVIADCNADADFVASDLLSQ
AEHGVDSQVILIGVGLSDEKLNEFQNAVEKQAQVLPRKEIVAKCLAHSYILLAKTYQEAF
DLSNQYAPEHLILQIDDAPSYVPDMIENAGSVFVGALSPESCGDYSSGTNHTLPTYGYAR
QYSGVNTATFQKFITSQEVTEDGLKNIGKAVMELARVEGLEAHRRAVEIRMDRIT
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgactttccctgttttgcctgttatttcttctcccgaagatagagaatcaattaatgag
ttttctttagtgggtcaagtaattttcccaatagaaagtgttagtatcaagaaacacttt
attcatcaatttccacatgacgtggatatttttgtaaatgctattgataatgccagtatt
gaccaaattgttgagttgttgaacgttgggatcaagcaggtgtttgttaatgagactcaa
tatcgtgaagctattgaagcaggcttaccaagtgctagatttgttgtgtctgttgatgtc
ccaagtgctgaattagtggcatctgaagcatcctttgttgttactaaaccatttcctgag
gggaatttgaaagaatataatgcgaatgaaaacagggttttatatatcaaatctgatttc
acacaggatgaggccattgaattggctaaaaactatattccagtgattccaagctcgaaa
ttgtctgtcaaacgtgaagaaaagaacaagatatcaatttctgctgtgtttgttagtaca
ttgactaccgacagaccagatgggttgtacaccacattaatcacaacgccatccccttct
tatacggcattgggtatagtgtattcctccaaggactctatagttgctgcaattgaagag
aaagttggggtttatcaatcacgtaaacgcagagatgaattatggtacaagggcaaaacc
agtggtgctacccagaaattagttaagttatccaaggattgtgattctgatgtgattcag
tttatggtagaaccacgaactggctatgggttctgccaccgtgaaaccaaatttacatgt
tttggtgatgatatggcagactctccagctagaggattgcccaaattagatagtactttg
caagacagattagaaaatgcacccgagggatcctatactaaacgtttatttgatgacgaa
aaattattgattgccaaattgaaggaagagttggatgaattgattgaagccaagtcgaag
gaggaaattgcttgggaatgtgccgatttggtttattttgccatggtctggtgcatcaaa
catggagtgagattggctgatgttgaaaagaatttggacgtaaagtccttgaaagtttcc
agaagaaaaggagacgccaagcctaagtaccaagagcctactaccaatagcagctataag
ttggagattgttagcattgatgatgctgctgctgttgagcgtgcaatgacaagacctgtt
cagaagactgcagacattatgaaacttgtgcttcctattattgaaaaagtgaaatctgat
ggtgacaaagctcttattgagttgacatccaagtttgatggtgtgaaacttgacacacct
gttttacaagctccgttccctgctgagctgatggatatttccgaagaaatgaaagctgct
attgacttgtcaatgcagaatatcgaaaaattccatgctgcacaattacccaaggaaaag
gttatgacggtagaaacatgtcctggtgtgttctgttctagatttgccaagccgattgaa
aatgttggattgtatgttccaggtggtacagcagtattaccttctacggcaatgatgttg
ggtgttccagcaaaagttgctgggtgtaagaatattataattgcgtctcctccgtcacgt
gctacagggaagttgacgccagaagttgtctatgttgcgcacaaattgggagcaaagtgt
attgttatggcaggtggtgctcaagcagttacggcaatggcatatggtactgaaagtgtg
ctcaagtgtgacaagatcttgggtcccggaaaccagtttgttactgctgccaagatgtat
gttcagaatgatacccaagcattatgttcaattgatatgccagcggggccatctgaggtt
ttggttattgcagattgcaatgccgatgctgactttgttgctagtgatttgctttcacaa
gctgagcatggtgtagactctcaggtaattcttattggtgttggattgagcgatgagaaa
ttgaatgagttccagaatgcagtagagaaacaagcccaagtgttgccaagaaaggagatt
gttgctaaatgtttggcccattcatacattttgttggctaaaacataccaagaagccttt
gatttgtcgaatcaatatgctcctgaacatttgatattacaaatcgacgatgctccatct
tatgttcctgatatgattgagaatgccggttcagtttttgttggagcattgtcacctgaa
tcctgtggggattactcaagtgggactaaccacactttgccaacgtatggttacgccaga
caatattctggagtcaatactgctactttccagaagtttattacttctcaagaagttaca
gaagacgggcttaagaatatcggcaaagcggtaatggaattagcaagagttgaggggttg
gaagctcacagaagagcagttgaaatcagaatggataggattacatag

DBGET integrated database retrieval system