KEGG   Candida dubliniensis: CD36_42190Help
Entry
CD36_42190        CDS       T01140                                 

Definition
histone deacetylase, putative
Orthology
K11484  
histone deacetylase HOS3 [EC:3.5.1.98]
Organism
cdu  Candida dubliniensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:464845..466986
Genome map
AA seq 713 aa AA seqDB search
MSTSRNTLSNHDNDSEDSLIEAFETTLSIRPTTTEYEDNDISIDHTTLPHTTINSINYTR
DASIVDIEELEENEQISEQIPKFKTKRRYSLLPKITAFKKTGSPGLEEYYNQQKLDPKFD
AILKPSVLLDESLTKYNHAFDEFLRSNPHIEKESPRFIHDSNKTLIVLSPYSAEHAFGRK
WVTKSYLSTIFERPQRLLASCIGVASAVSMFPFYYKVTNSTKRGSVFSSHVRKIHGRNWP
KKLFELCLESHEKLNNDELEVPEDWNVGDIYLTPKTINAIEGVIGTIETAIDSLFSKRKK
ENHNLAFVVIRPPGHHSHACLPSGFCLLNNVQIGIEYAFEQYGVTHCAILDIDLHHGDGS
QDICWERAGFTGDYGQQEEDEIVDPKLNPRDDYGKRFATYPKVGYFSIHDIKSYPTEIGY
ATKENIKNASTCIMDHDLNIWNVHLQEWSNEDEFYKHYQTKYVAILNRANQFLNSAKKQY
EQEYEEYIENLGKYNKYLLKPHLFNSPLTKPTPPPPFKPLIAISAGFDASQYENPQMQRH
GINVPTSFYSTFTKDVVKLAKIHTNGKVLSFLEGGYSDGALSTGIFSHLIGLNNDDEFLW
NHSWGSQQVMKELVKGCKKNWTPYKKPQSDITIWANEVIKLGRAMMPNAILPTNYVYDDQ
TKQSNRPMNKMVKELMDSRGKAVEVDSPIRKDPEDDRKVMRHTRSYYKKVSNI
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacttcaagaaataccctatcgaatcatgataatgatagtgaagattcattaatt
gaagcatttgaaacgacattgagtattcgtcctacaacaactgaatatgaagataatgac
atttctatagaccataccactttaccccatactaccataaacagtataaactatacaagg
gatgccagcattgttgatattgaggaattggaagaaaatgaacaaatcctggagcaaatc
cccaaattcaaaaccaaaagacgatacagtttacttcctaaaatcactgcatttaaaaaa
actggttctccgggattagaggaatattataatcaacagaaacttgaccctaaatttgat
gctattttgaaaccatcagtattactcgatgaatcattaactaaatataatcatgcattt
gacgaatttttacgttccaacccacatattgaaaaggaatcacctagatttattcatgac
tcgaataaaacattaattgtactatcaccatactctgcagaacatgctttcgggagaaaa
tgggtcactaaatcatatttatcgacaattttcgaacgtccacaaagattattagcgagt
tgtattggtgttgcatcagcggtatcaatgtttcccttttattataaagtgacaaactcg
accaagcgaggttcggtattttcatcgcatgttcgtaaaattcatggtcgtaattggccg
aaaaaattgtttgaattgtgtctcgaatcacatgaaaaattgaataatgacgaattggaa
gtaccagaagattggaatgttggagatatttacttgactcccaaaactataaacgctata
gaaggagtgattggaaccattgaaaccgccattgattctttatttctgaaaagaaagaaa
gagaatcacaatcttgcatttgttgtcattagaccaccagggcatcatagtcatgcttgt
ttacctagtgggttttgtttattgaataatgttcaaataggtatagaatatgcatttgaa
caatatggcgtaactcattgtgccattttagatattgatttgcatcatggtgatggatca
caagatatatgttgggaacgagcagggtttactggagattatggtcaacaagaagaagat
gaaatagttgatcctaaattgaatccacgtgatgattatgggaaaagatttgctacttat
cctaaagttggctatttttcaatccatgatatcaaatcatatcccactgaaattggttat
gcaacaaaggagaatattaaaaatgcgtctacttgtattatggatcatgatctcaatata
tggaatgtccatttgcaagaatggagcaatgaagatgaattttataaacattatcaaacc
aaatacgttgcgatattgaatagagctaatcaatttttaaacagtgccaaaaagcaatat
gaacaagaatatgaagaatatattgagaatttgggtaaatataacaaatacttgttgaaa
ccacatttgtttaatctgccattaactaagccaacaccacctcctccttttaaacctttg
attgccattagtgctgggtttgatgcatcacaatatgaaaaccctcaaatgcaacgacat
gggatcaatgtccccacgtcattttattcaacattcactaaagatgtagttaaattagcc
aaaattcataccaatggcaaagtattatcatttttagaaggtggatattcggacggtgct
ctttcaacaggtatattttcacatttaattggattaaataatgatgatgaatttttatgg
aatcattcctggggatcacaacaagttatgaaagaattagttaaaggatgtaaaaaaaat
tggaccccatataaaaaaccacaaagtgatataacaatttgggccaatgaagtaattaaa
ttgggtagagccatgatgcccaatgcgatattaccgacaaattatgtttatgatgatcaa
actaaacaactgaataggccaatgaataaaatggtgaaagaattgatggattccagagga
aaagcagttgaagtggatagtccaataagaaaagaccctgaagatgacaggaaagttatg
agacacacacggtcatattacaagaaagtatccaatatatag

DBGET integrated database retrieval system