KEGG   Candida dubliniensis: CD36_43030Help
Entry
CD36_43030        CDS       T01140                                 

Gene name
NCP1
Definition
(RefSeq) NADPH-dependent cytochrome P450 reductase, putative
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
cdu  Candida dubliniensis
Brite
Enzymes [BR:cdu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     CD36_43030 (NCP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 8047708
NCBI-ProteinID: XP_002419965
UniProt: B9WG11
Position
4:680195..682237
Genome map
AA seq 680 aa AA seqDB search
MALDKLDLYVIVTLVLAVAAYFAKNQFLTKPQDTGFLSNEGTGGNSRNILETLKKNNKNT
LLLFGSQTGTAEDYANKLSRELHSRFGLSTMVADFADYDFDNFGDISNDILVFFIVATYG
EGEPTDNADEFHTWLTDEADTLSTLRFTVFGLGNSTYEFYNAIGRKFDQLLEEKGGERFA
EYGEGDDGTGTLDEDFLSWKDGVFDSLKNNLNYEEKELKYEPNVKLTERDDLTVDDSNVS
LGEPNKKYINSQGADLTKGPFDHTHPYLAKITKTKELFNSKDRNCVHIEFDISDSNLKYS
TGDHLAVWPSNSDENIKQFLKCFGLENKENTVIELKALDSTYSIPFPSPITYGAVIRHHL
EISGPISRQLFLSIAGFAPNEETKATLTRIGNDKKEFASTITRRKFNIADALLFASKGEA
WVDVPFEFIIENVQHLTPRYYSISSSSLSEKQLINITAVVEAEVESDGRAVTGVVTNLLK
NIEIEQNNTNEKPLVHYDLNGPRSKFSKFKLPVHVRRSNFKLPKNTTTPVILIGPGTGVA
PLRGFVRERVQQVKNGVNVGKTILFYGCRNEHDDFLYKQEWSEYASVLGDKFQMFNAFSR
QDPSKKVYVQDKIVENYKTVNELLNNGATIYVCGDASRMARDVQAAIAKIVAKDRNITQE
SATELVKSWKVQNRYQEDVW
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggcattagacaaattagatttatacgttatcgtgacattggtgcttgcagtagcagca
tatttcgctaagaaccaatttctcaccaaaccacaagacactggtttcctttccaacgaa
ggtactggtggaaattcaagaaacatattggagacattgaagaaaaacaataaaaataca
ttattattatttggatcacaaactggtactgctgaagattatgccaataaattatctcgt
gaattgcattccagatttgggttaagcaccatggttgctgattttgctgattatgatttt
gataattttggtgatatttccaacgacatcttggtatttttcattgttgctacttacggg
gaaggtgaacccactgataatgccgacgaattccatacttggttaactgatgaagctgat
accttgagtactttgagatttactgttttcggattaggtaactctacttatgaattctat
aatgccattggtagaaaatttgaccaattattagaagaaaaaggtggtgaaagatttgct
gaatacggtgaaggtgatgacggtactggtactttagatgaagatttcttatcttggaaa
gatggcgtttttgattcattgaagaacaatttgaattatgaagagaaagagttgaaatac
gaaccaaatgtcaagttgactgaacgtgatgatttaactgttgatgactctaatgtctca
cttggtgaaccaaacaaaaagtatatcaattctcaaggcgctgatttaaccaaaggtcca
tttgaccacacccatccatatttagccaagataactaagacaaaggaattatttaactcc
aaagatagaaattgtgttcatattgaatttgatatttccgactccaacttgaaatacagc
actggtgatcatttagcagtttggccatctaattcagatgagaatatcaagcaattcctt
aaatgctttggtttagaaaacaaggagaacactgttatagaattgaaagcattagactct
acttattcaatccctttcccaagtccaattacctatggtgctgttattagacaccatttg
gagatctctggaccaatttcaagacaattgttcttatccattgccggatttgcacctaat
gaagagacaaaggctacattgactagaattggtaacgataaaaaagagtttgcttccaca
attacccgtagaaagttcaatattgctgatgcattgttgtttgcttccaaaggtgaagct
tgggttgatgttccatttgaattcattattgaaaatgttcagcatttgacacctcgttac
tactcgatttcttcttcttctttaagtgaaaaacaattgatcaatattactgctgttgtt
gaagctgaagtcgaaagtgacggaagagctgttactggtgttgttactaatttattgaag
aacattgaaattgaacaaaacaataccaacgaaaagccattagttcattatgatttaaat
ggtccaagaagcaaattcagcaagtttaaattaccagttcacgttagaagatccaacttt
aaattaccaaagaataccaccactcctgtcattttgattggaccaggaactggtgttgct
ccattgagaggatttgttagagaaagagtacaacaagttaagaatggtgttaatgttgga
aagactattttattctatggttgcagaaacgaacacgatgatttcttgtataaacaagaa
tggtctgaatatgccagtgtattaggtgacaaattccaaatgtttaatgctttttcaaga
caagatccatcgaaaaaagtgtacgtgcaagataaaattgtggaaaattacaaaactgtt
aacgaattgttgaacaatggtgctaccatttacgtttgtggtgatgccagtagaatggca
agagacgttcaagcggccattgctaagattgttgccaaagatagaaatatcactcaagaa
agtgccactgaattagttaagtcttggaaggttcaaaatagataccaagaagatgtttgg
taa

DBGET integrated database retrieval system