KEGG   Candida dubliniensis: CD36_43230Help
Entry
CD36_43230        CDS       T01140                                 

Definition
ubiquitin carboxyl-terminal hydrolase putative
Orthology
K11873  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
cdu  Candida dubliniensis
Brite
Enzymes [BR:cdu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CD36_43230
Peptidases [BR:cdu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CD36_43230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(723448..725637)
Genome map
AA seq 729 aa AA seqDB search
MYQSSSPKPQLSINNNSSSITTNSTTTINPLLFATPLNFKPASSTTLTSTFDNQIPKSYI
VLSNNSNMKNSKLQKDNKLVKANTKKSTNDPPKPKSLNEAIANYTGNKYLTHKERKRKRK
LQERNNEEKQDQEEEEEEDNGERRVTKKAKRGMWDSIKSFLSGTPTPLSDEEDLGENIEE
NREQKEEKEEEGDDKIEDDDSSSSGEVLTETSPFTGFSEPEKSEIDDIEEEEDDADFVDE
DSDSPESSDQDDEDVESDSVSSQPSDNDEEDLEKLKYDLKIDQLVNGKDDNEEDEDEDEE
EEETQERTSTTPPTSPEEDTEKQQPEPSEVSYYDINEYEDDRGSNNSTRIYKNWRELVNK
KPPVGLLNHGVTCYMNSAIQSIIHIPAMQHYLNDVNDNKYSQLKPRSVTHVLAELSKRMW
LASNTNNNKKGKNSGGMKYINPKKIIQRLDEINCMMSEWQQEDSHEYYMSLISRLQEDST
PKGKKLNESIIYDIFGGLLNQRITCHKCHNVSITKQEFYDLSLGLNKKKAKPHSSNDDNN
SINNNNNNNNNNSNDETTSTTIDPSSTTMFNSNKFSIEKSINDFFSNELIKKSENDSKSG
YFCEKCNRFTHANKISSIEIAPETLTIHFKRFKFNNNSSSKVKQSINYSKYLDLSKYMVQ
GTAKYRLTSVIVHEGRSISSGHYVAHCLQPDGYTWCTYDDEYINKIEERVALNDPSAYVL
VYTKLTPKV
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaatcttcatctcctaaaccacagctaagcattaataataactcctcaagcatc
accactaattcaactacgacaatcaatccgttactttttgcaaccccattaaacttcaaa
ccagcatcatccaccacattaacatctacatttgataatcaaataccgaaatcatatatt
gttttatctaacaattctaatatgaaaaattccaaacttcaaaaagataataaactagtt
aaagcaaatacgaagaaatctactaatgacccaccaaaacctaaatctttaaatgaagca
attgctaattatactgggaataagtatttgactcataaggagaggaaaaggaaaagaaaa
ttacaagaaagaaataatgaagagaaacaagaccaagaggaagaagaggaagaagataat
ggagaaaggcgtgtaactaaaaaagcgaaaagaggaatgtgggattctatcaaatcattc
ttactgggtacaccaaccccactttcagatgaggaagatttgggtgagaatatagaagaa
aaccgggaacaaaaggaagaaaaggaggaggaaggtgatgacaaaatagaagacgatgat
tcaagttcctctggtgaagtattgactgaaacatcaccatttactggatttagtgaacca
gaaaaaagtgaaatcgacgacattgaagaagaggaagacgacgcagattttgtggatgaa
gattcagattcacctgaaagtagtgatcaagatgatgaagatgttgaatcagattctgta
tcatcacaaccatctgataatgacgaagaggatttagaaaagttgaaatatgatttaaaa
atcgatcaattagtcaatggcaaagatgacaacgaagaagacgaggatgaagacgaagaa
gaagaggaaacacaagaacggacatcaactactccaccaacatcaccagaagaggacacg
gaaaaacaacaaccagagccactggaagtttcgtattatgatattaatgaatatgaagac
gatcgtggatccaacaattctactaggatatacaagaattggagagaattagttaataaa
aaacctcctgttggattattgaaccatggtgtcacatgctacatgaattcagcaattcaa
tcaattattcatataccggcaatgcaacattatttaaacgatgtgaatgataataaatat
tctcaacttaaaccaagatcggtgactcatgttttagctgagttatctaaaagaatgtgg
ttagcatcgaatactaacaacaataaaaagggtaaaaatagtggtgggatgaaatatatt
aatccgaaaaaaatcattcagagattggatgaaatcaattgcatgatgagtgaatggcaa
caagaagattctcatgaatattatatgtcattaatctctagactacaagaagactctaca
ccaaaggggaaaaaattgaatgaatcgattatatatgatattttcggtggattattgaat
caacgtatcacatgtcataaatgtcataatgtttcaatcacaaaacaagaattttatgat
ttatcattagggttaaataaaaagaaagccaaaccacacagcagcaacgacgacaacaac
agcattaataataataacaataacaataacaataatagtaatgatgaaactacgtccact
actatcgatccctcctccaccacaatgtttaatagtaataaattctcaattgaaaaatct
attaatgattttttcagtaatgaattaattaaaaaactggagaatgatagcaaatcaggg
tatttctgtgagaaatgtaatcgattcactcatgccaataaaatttcttcaattgaaatt
gctccagaaacattaaccattcattttaaacgatttaaattcaataataattcttcatcc
aaagttaaacaactgataaattatagcaaataccttgatttaagcaaatatatggttcaa
ggaactgctaaatatcggttgacatcagttattgttcatgaaggtagatcaatttctagt
ggacattatgttgctcattgtttacaacctgatggatatacttggtgcacttatgatgat
gaatacattaataaaattgaggaaagagtggcattaaatgatccttcggcttatgtatta
gtatataccaaattgaccccaaaggtttaa

DBGET integrated database retrieval system