KEGG   Candida dubliniensis: CD36_43680Help
Entry
CD36_43680        CDS       T01140                                 

Definition
hypothetical protein
Organism
cdu  Candida dubliniensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:882436..884925
Genome map
AA seq 829 aa AA seqDB search
MMSHQQLINPHGYNSGGDGESIISVDKELPTSCTSSSINIIAKFIKMISIKFQKIPPFRI
KWFISTIAIVIYSTIFNITNLIMFSKFTKNFNSVNPLSVIFLFLDVFIFLVVIYEKFYHK
NNNEFTNKWSKYTYIIVCKILKKILWLILLIACIFQVVLISIGKLSNPLNVNDNQLDILN
MSQHEKTGYFIVNLINLVFNGALLGIWWSTNISSVYLLFASINFINILIAISLVQINISY
FNLTSGSVRKLHNLFIITGTFMTGQSAIGLSIVLLINEKNRLKDFIGKLIFFYDVYVTLL
FSLLLGCTIVSGIYFDYKASFPISIFILYLCSIIISVVSFLCTRYFRLRGGFTNEYQVEE
YDLLSLTVHQKQGWGKLIDINHKYNGGISGDYVISLMENYMEADLPGMSCKVLRVFKKNE
TTITTTTTQLSQKLKHQSKKNLNTAFEDLDHESLLFQDTPTLCDTTSSIKHLEDEYRPLS
KNQLKRLAKKNQKDKKLLELKSLENNTEIFYQELMNTEALILLTIIEEFDLSERIPGWIG
KKLNKWFGKNSKYPFLCIRFGLLGFHWPFKRSTFYCSATKKPVARGAAVLYAISQWNSQH
EKLTVLLDPTYKDVNFEAGITSSGWYKIKLPNSHIIDLRPFQNQTSTDYFKAIKYRTQDN
SFKQANGQVIETNIFNYENCQEIINMNQNISQNRQSSGQSQQLLQPNWEFIYNLGNYSNE
KKYRSLLFLKVDNEIIASCVIFRLGDTMTSDIQGLNHVISKKYKAYFVMMQEVIKIGLRE
GVKFIDFGPTTEEAKVTIGCNVVPLCGSIYPKNKFLGPIIKFAASKVDV
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atgatgtctcatcaacaactcattaatccacatggatataatagtggaggtgatggagaa
agtattatactggtggataaagaattaccaacttcttgtacttctagttcaattaatatt
atagcaaaattcataaaaatgatatctattaaattccaaaaaatccctccatttagaata
aaatggtttattagtactattgctattgtcatttattcaacaatttttaatataaccaat
ttaattatgttttctaaatttactaaaaatttcaatctggttaatccattatcagtgatt
tttttatttttagatgttttcatatttcttgttgttatttatgaaaaattttatcataaa
aataataatgaattcactaataaatggtcaaaatatacttatataatagtttgtaaaata
ttgaaaaaaattttatggttgattttattaattgcttgtattttccaagtggttttaatt
tccattggtaaattatctaatccattaaatgttaatgataatcaattggatattttaaat
atgtcacaacatgaaaaaactggatactttatcgttaatttaattaatttagtatttaat
ggtgcattattagggatttggtggtcaactaatatttcatcagtttatttattatttgct
tcaattaatttcataaatattttgattgccattagtcttgtccaaattaatattagttat
ttcaatttaactagtggatcagtaaggaaattacataatttatttataataactggaaca
tttatgacaggacaatcagctatcggtttaagtattgtattattgattaatgaaaaaaat
cgattgaaagatttcattggtaaattgatttttttttatgatgtttatgtgacattatta
ttcagtttattattaggatgtaccattgttagtgggatttattttgattataaagccctg
ttccccattagtattttcatattatatctttgttccattattatttcggttgtgtcattc
ttatgtacacgatatttccgtttacgtggtggatttactaatgaatatcaagtggaagaa
tatgatttactttcattaacggttcatcaaaaacaaggatgggggaaacttatagatatt
aatcataaatataatggaggaatttctggtgattatgtcatttcattaatggaaaattat
atggaagcagatttaccaggaatgtcatgtaaagtattaagggtattcaaaaagaatgaa
acaacaataacaacaaccacaacccagttgctgcaaaaactaaagcatcaaagcaaaaag
aatttaaacactgcatttgaagatttagatcatgaatcattattatttcaagatactcca
acattatgtgacaccacatcatcgattaaacatttagaggatgaatatcgaccattatcg
aaaaatcaattgaaacgattagctaaaaaaaatcaaaaagataaaaaattattagaatta
aaatctttagaaaataatactgaaattttttatcaagaattaatgaatactgaagcatta
atattacttactattattgaagaatttgatttaagtgaaagaatcccaggatggattggt
aaaaaattgaataaatggtttgggaaaaattcgaaatatccatttttatgtattcgattt
ggattattaggatttcattggccatttaaacgatcgactttttattgtagtgccaccaaa
aaacctgtagctcgtggtgctgctgtgctatatgccatatctcaatggaattctcaacat
gaaaaattaaccgtattattagatccaacttataaagatgttaattttgaagcagggata
acttctagtggttggtataagattaaattacctaattctcatattattgatttaagacca
tttcaaaatcaaactagtactgattatttcaaagccataaaatatagaactcaagataat
tcatttaaacaagctaatggacaagtaattgaaactaatatatttaattatgaaaattgt
caagaaatcattaatatgaatcaaaatatttctcaaaatagacaactgtcaggacaatca
caacaattattacaaccaaattgggaattcatttataatttaggaaattattctaatgaa
aaaaaatatcgttccttgttgtttttaaaagttgataatgaaatcattgcttcatgtgtt
atatttcgtttaggtgatactatgacttcagatattcaaggattaaatcatgttataagt
aaaaaatataaagcatattttgttatgatgcaagaagtaattaaaattggattaagagaa
ggagttaaatttattgattttggtccaactactgaagaagctaaagttactattggttgt
aatgttgtaccattatgtggatcaatttaccctaaaaataaattcttaggaccaatcata
aaatttgctgctagtaaagttgatgtataa

DBGET integrated database retrieval system