KEGG   Candida dubliniensis: CD36_44420Help
Entry
CD36_44420        CDS       T01140                                 

Gene name
PMT6
Definition
dolichyl-phosphate-mannose-protein mannosyltransferase, putative
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
cdu  Candida dubliniensis
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:cdu00514]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:1060807..1063326
Genome map
AA seq 839 aa AA seqDB search
MATGYSTGASPFGLDDNSHNDSIHHRHQKQHNQSPDSLDVYEQDDIEIEDIIQKTSQLHI
NTPTSTRIKNFFFPSSRRHNANSSSHSPQLREVFIKTINPLILTAISSFVRLYRIDVANS
VVWDEAHFGKFGSQYLKRQFYFDVHPPLGKLLIGLSGYLADYDGSFEFESSNVYSDNVNY
VFMRIFNCFFGILVTPLAYKTAVLLGYNQFTCWLIAFMVIFEQLSLTLSKFILLDSMLLF
FTVLTMYCLIKVHTLAMARGGSNTRPPLTKLEIKWFILAGISIGCVCSVKWVGLFVTALV
GFYTIFDLWLKFYQTFAIDDKSPKKMSVGSYLIHWAVRIVTLIIIPITIYVATFKVHFMV
LNHTGPDDGTLSTLLQGSLIGNDLQSGPRSVAFGSLVTIRSQGLSPNLIHSHPHNYPQGS
QEQQVTTYGFKDDNNEFLFEFGVDAGLRNQHATLENGNSTASGGEDDDDDYYHVIIHDGD
TVRINHKNTGCYLRANAVGAPVTSSSYEVSCFGDVESNDWADEWVIEIQTQDQSPDPIFQ
DEDRSEIHSVSTSFRLKHKQLGCYLATTGKSYPAWGYQQGEVVCKYSVFSRDKNTWWNIE
KHVNDKLPLPPTEYVPPKPKFWKEFILLNYAMMASNNALIPDPDRFDKLSSEWWEWPILN
TGLRMNSWGDADIKYFLLGNPLITWLSTMALIACPVYLLIVGIKYQRQWISLSATDASNT
NSVNKQTLSLLSARALLPLAGWVLHYVPFILMGRVKYLHHYVPALYFAIFIAGFIVDAIV
NLDFSYHNNKFQYIFKVVIYSTLYLVICISFWYFKDLSFGMEGSSVAFRHLRLLGSWMI
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgggctattccacgggtgcatcaccttttggtttggatgacaatagtcacaat
gattcaattcatcatcgtcaccaaaaacaacacaaccagagccctgattctttggatgtt
tatgaacaagacgatattgaaattgaggatatcattcaaaagacatcgcaacttcacatc
aatactcccacgtcaacaagaataaaaaactttttcttcccctcatcaagacgtcacaat
gcaaattcatcgtcacattccccacaattgagggaagtgtttattaaaaccattaatccg
ctaatattaaccgcaatttcaagtttcgttcgactttatcgtattgacgtggccaatagc
gttgtatgggacgaagcacattttggaaagtttggttcacaataccttaaacgacagttt
tattttgacgtgcatccaccattgggtaaattgttaataggattgtcgggatatttggct
gattacgatggcagttttgaatttgaaagttcaaatgtttattctgataatgttaattac
gtgtttatgagaattttcaattgctttttcggaattcttgttacaccgttagcatacaaa
actgctgtattactagggtataaccagtttacttgttggttgattgcctttatggtaatt
tttgaacaattgtctttgacattatcaaagtttattttattggattcaatgttactattt
ttcacggttttgacaatgtattgtttgattaaagtacacactttagctatggcccgtggt
ggtagcaataccaggccaccattaacgaaattggaaatcaaatggtttattctagctggt
atttcaatagggtgtgtctgttctgttaaatgggtaggattatttgttacagctctagtt
ggattttatacaatttttgacttatggcttaagttttatcaaactttcgctatcgacgac
aagtctcctaaaaaaatgtcagttggcagttatttaattcattgggctgttagaattgtt
acattgataattatccccataacaatttatgttgccacttttaaagtacattttatggta
ttgaatcataccgggcctgacgatggtaccttatcaactttattacaaggatcattaata
ggaaatgatctacaatccggccctagatcagtggcttttgggtcattggttactattaga
tcacaaggattatcgcctaatcttattcattcacacccccataactatcctcaagggtca
caagagcaacaagtaaccacatatgggtttaaggacgataataatgagtttttgtttgag
tttggtgttgatgccgggttacgcaatcaacacgcgacattagaaaatggaaatagtact
gcgagtggtggtgaggatgacgatgatgattattaccatgtaataattcatgatggtgat
actgtgagaatcaaccacaaaaacaccgggtgctatttacgagccaatgctgtaggtgct
cctgtgacttcaagtagttatgaagtgtcatgttttggtgatgttgaaagtaatgattgg
gcagatgaatgggtaatagaaattcaaacacaagaccaatcaccggatccaattttccag
gatgaagaccggctggaaatacactcagtgtcgactagtttccgattgaaacacaaacaa
ttaggatgctatttggctaccactgggaaatcgtacccagcgtgggggtatcaacagggt
gaagttgtttgcaaatattctgttttcagtcgtgataaaaatacgtggtggaacattgaa
aaacatgttaatgataaattgccattaccaccaactgaatatgtgccaccaaaaccaaaa
ttctggaaagagtttattcttttgaactacgccatgatggcatccaacaatgccttgatc
cctgacccagaccgatttgataaactcagttctgagtggtgggaatggccaatattgaac
actggcctcagaatgaatagttggggtgacgccgatattaaatattttcttttgggtaat
ccattgatcacttggttgtcaacaatggcgttgattgcatgtcccgtttacttattgatt
gttggcatcaaatatcaacgacaatggatatcattatcagcaacagacgctagcaacacc
aattcagtgaacaagcagacattatcattactatcggctcgagcattgcttccattggca
gggtgggttttgcattatgttccgtttattttaatgggaagagtcaagtatcttcatcat
tatgtcccagcattatattttgccatctttattgctgggtttattgttgatgccatagta
aatttggatttttcttatcataacaataaatttcagtatatattcaaagtggtgatctac
tcaacgttatacttggtgatttgcataagtttttggtatttcaaagatctttcttttggt
atggaggggtcatcggttgcttttcgacacttacgacttttaggttcatggatgatataa

DBGET integrated database retrieval system