KEGG   Candida dubliniensis: CD36_44420Help
Entry
CD36_44420        CDS       T01140                                 

Gene name
PMT6
Definition
dolichyl-phosphate-mannose-protein mannosyltransferase, putative
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
cdu  Candida dubliniensis
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    CD36_44420 (PMT6)
Enzymes [BR:cdu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     CD36_44420 (PMT6)
Glycosyltransferases [BR:cdu01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   CD36_44420 (PMT6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:1060807..1063326
Genome map
AA seq 839 aa AA seqDB search
MATGYSTGASPFGLDDNSHNDSIHHRHQKQHNQSPDSLDVYEQDDIEIEDIIQKTSQLHI
NTPTSTRIKNFFFPSSRRHNANSSSHSPQLREVFIKTINPLILTAISSFVRLYRIDVANS
VVWDEAHFGKFGSQYLKRQFYFDVHPPLGKLLIGLSGYLADYDGSFEFESSNVYSDNVNY
VFMRIFNCFFGILVTPLAYKTAVLLGYNQFTCWLIAFMVIFEQLSLTLSKFILLDSMLLF
FTVLTMYCLIKVHTLAMARGGSNTRPPLTKLEIKWFILAGISIGCVCSVKWVGLFVTALV
GFYTIFDLWLKFYQTFAIDDKSPKKMSVGSYLIHWAVRIVTLIIIPITIYVATFKVHFMV
LNHTGPDDGTLSTLLQGSLIGNDLQSGPRSVAFGSLVTIRSQGLSPNLIHSHPHNYPQGS
QEQQVTTYGFKDDNNEFLFEFGVDAGLRNQHATLENGNSTASGGEDDDDDYYHVIIHDGD
TVRINHKNTGCYLRANAVGAPVTSSSYEVSCFGDVESNDWADEWVIEIQTQDQSPDPIFQ
DEDRSEIHSVSTSFRLKHKQLGCYLATTGKSYPAWGYQQGEVVCKYSVFSRDKNTWWNIE
KHVNDKLPLPPTEYVPPKPKFWKEFILLNYAMMASNNALIPDPDRFDKLSSEWWEWPILN
TGLRMNSWGDADIKYFLLGNPLITWLSTMALIACPVYLLIVGIKYQRQWISLSATDASNT
NSVNKQTLSLLSARALLPLAGWVLHYVPFILMGRVKYLHHYVPALYFAIFIAGFIVDAIV
NLDFSYHNNKFQYIFKVVIYSTLYLVICISFWYFKDLSFGMEGSSVAFRHLRLLGSWMI
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgggctattccacgggtgcatcaccttttggtttggatgacaatagtcacaat
gattcaattcatcatcgtcaccaaaaacaacacaaccagagccctgattctttggatgtt
tatgaacaagacgatattgaaattgaggatatcattcaaaagacatcgcaacttcacatc
aatactcccacgtcaacaagaataaaaaactttttcttcccctcatcaagacgtcacaat
gcaaattcatcgtcacattccccacaattgagggaagtgtttattaaaaccattaatccg
ctaatattaaccgcaatttcaagtttcgttcgactttatcgtattgacgtggccaatagc
gttgtatgggacgaagcacattttggaaagtttggttcacaataccttaaacgacagttt
tattttgacgtgcatccaccattgggtaaattgttaataggattgtcgggatatttggct
gattacgatggcagttttgaatttgaaagttcaaatgtttattctgataatgttaattac
gtgtttatgagaattttcaattgctttttcggaattcttgttacaccgttagcatacaaa
actgctgtattactagggtataaccagtttacttgttggttgattgcctttatggtaatt
tttgaacaattgtctttgacattatcaaagtttattttattggattcaatgttactattt
ttcacggttttgacaatgtattgtttgattaaagtacacactttagctatggcccgtggt
ggtagcaataccaggccaccattaacgaaattggaaatcaaatggtttattctagctggt
atttcaatagggtgtgtctgttctgttaaatgggtaggattatttgttacagctctagtt
ggattttatacaatttttgacttatggcttaagttttatcaaactttcgctatcgacgac
aagtctcctaaaaaaatgtcagttggcagttatttaattcattgggctgttagaattgtt
acattgataattatccccataacaatttatgttgccacttttaaagtacattttatggta
ttgaatcataccgggcctgacgatggtaccttatcaactttattacaaggatcattaata
ggaaatgatctacaatccggccctagatcagtggcttttgggtcattggttactattaga
tcacaaggattatcgcctaatcttattcattcacacccccataactatcctcaagggtca
caagagcaacaagtaaccacatatgggtttaaggacgataataatgagtttttgtttgag
tttggtgttgatgccgggttacgcaatcaacacgcgacattagaaaatggaaatagtact
gcgagtggtggtgaggatgacgatgatgattattaccatgtaataattcatgatggtgat
actgtgagaatcaaccacaaaaacaccgggtgctatttacgagccaatgctgtaggtgct
cctgtgacttcaagtagttatgaagtgtcatgttttggtgatgttgaaagtaatgattgg
gcagatgaatgggtaatagaaattcaaacacaagaccaatcaccggatccaattttccag
gatgaagaccggctggaaatacactcagtgtcgactagtttccgattgaaacacaaacaa
ttaggatgctatttggctaccactgggaaatcgtacccagcgtgggggtatcaacagggt
gaagttgtttgcaaatattctgttttcagtcgtgataaaaatacgtggtggaacattgaa
aaacatgttaatgataaattgccattaccaccaactgaatatgtgccaccaaaaccaaaa
ttctggaaagagtttattcttttgaactacgccatgatggcatccaacaatgccttgatc
cctgacccagaccgatttgataaactcagttctgagtggtgggaatggccaatattgaac
actggcctcagaatgaatagttggggtgacgccgatattaaatattttcttttgggtaat
ccattgatcacttggttgtcaacaatggcgttgattgcatgtcccgtttacttattgatt
gttggcatcaaatatcaacgacaatggatatcattatcagcaacagacgctagcaacacc
aattcagtgaacaagcagacattatcattactatcggctcgagcattgcttccattggca
gggtgggttttgcattatgttccgtttattttaatgggaagagtcaagtatcttcatcat
tatgtcccagcattatattttgccatctttattgctgggtttattgttgatgccatagta
aatttggatttttcttatcataacaataaatttcagtatatattcaaagtggtgatctac
tcaacgttatacttggtgatttgcataagtttttggtatttcaaagatctttcttttggt
atggaggggtcatcggttgcttttcgacacttacgacttttaggttcatggatgatataa

DBGET integrated database retrieval system