KEGG   Candida dubliniensis: CD36_44790Help
Entry
CD36_44790        CDS       T01140                                 

Definition
putative glycogen debranching enzyme (glycogen debrancher) [includes: 4-alpha glucanotransferase (oligo-1,4-1,4-glucantransferase) amylo-alpha-1,6-glucosidase (amylo-1,6-glucosidase (dextrin 6-alpha-D-glucosidase)]
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
cdu  Candida dubliniensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CD36_44790
Enzymes [BR:cdu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CD36_44790
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     CD36_44790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(1148119..1152723)
Genome map
AA seq 1534 aa AA seqDB search
MSEARTVLFRLSNLGEPVNNENISNGVLILPVVELPTNYQPGDVLFQLRFQLNAASKVSR
NGVLYTNVPPKYEQEFDRNTHYQYPIKSSFHQDIQIIVPIYKPGSYNYYIEYDDEEDNKK
TTEKYYFNVPPNLTINGKFVPFNNINVETVVSKWIGPYENWDKFFKIVAQKGYNMIHFTP
LQERGESDSPYSIYDQLKFDPKIFPGSDQDSIQKIHKVLNDNQLLSLTDVVWNHTANNSE
WLREHPDSGYNATTAPHLIPAIELDETLLEYSHNLQELGLPTVLESEADLQKVMDGIQTH
VLEKLKLWEYYVFHKRQTIIDLEKSFKANKNNINRIQIPNDVDPQNLKQLSDYVLKVANI
NPTPIIADRFANKLNVDKLLEVLFTVFDGNVEFETIADKAEEIIDVINSDLYALFDDDTS
SIKQQIADRIKYLRLADNGPKLGEITDKSPLTEPYFTRFTDVNGKKQALANNGWIWGGNP
LVDFASNKSRAYIRREVIVWGDCVKLRYGEKFEDSPETWKRMIEYTQLSAKTFNGFRIDN
CHSTPLHVGERLLDEARKVNPNLYVIAELFSGSAEMDKIFVERLGINSLIREAMQAWSVG
ELSRLVHKHGGRPIGSLTWLPLDDFTYPAINEPIKDKYIDGYTELEIPKVLTCQAPHAIF
MDCTHDNETPAQKRTVEDTLPNAALVAFCSSAVGSVFGYDECYPKLLNVVSETRHYDLDS
DNGIGEIKGKLNKIRDNLVQESEDVTRDHEMYIHHEGQYITIQRYNARTGNGWFLIARSK
FSEHEPTQGLSPSILGGTKVKHEFSYTLKKQPGDYEPQSDKLTGIPVKVESIEDPSIEYT
EDGDSIITIDENIFIPGSIAVFSTEIPGVDVKLDNFVKQGAIEASIGLDLYDLNALLYRA
STEELDASHGKDDVYDIPGYGKLTYAGLEGWNTALKHVIWQNNLGHPICDHLRNGDWAFD
YVINRLDKYVVKSENLLKFQDWLRSRFDAVKNSKAPYFLRPHYFALIMGIAYEAARFRVI
RQMSEEIKEATNFVQSLALTSVQMVGYMQNTSLVPDKQVPCMAAGLPHFSNDYMRCWGRD
VFIAFRGLLIVTGRYDDAKQHILGFAKTLKHGLIPNLLDAGRNPRYNARDAVWFFLQAIQ
EYVTYVPNGINILDEKVTRRFPLDDTYIPYDDPQAFSYESSIREIIYEILARHAKGIKYR
EANAGPNLDSQMKDEGFNVEIGVDWNNGLIYGGNQFNCGTWMDKMGESEKAHNKGIPGTP
RDGSAIEIQGLLKSALRFVNKLHKQGKFDYTKVIKPDGTTISLKDWESLLGENFEKYYYI
PKDQQQDDQYIIDPSIVNRRGIYKDLYNSGKPFEDYQLRPNFAIAMCVAPELFTPEKALE
AIIIADKSIRGPIGMKTLDPLDWNYRPYYENSIDNDDFATSKGRNYHQGPEWVWNTGYFL
RAFLLFHHLHESKTKSFSFTSSSSLLSPSIKILTLLNDRLQGHIKWIKESPWNGLTELTN
KDGSYCQDSSPTQAWSGSCLLDLYYDLWNDKHFQ
NT seq 4605 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagcacgaactgttttatttcgattatccaatctaggtgaaccggtcaacaat
gagaatatttctaatggtgtgttaattttaccagtagtagaattaccaacaaactatcaa
ccaggtgatgttttattccagcttagatttcaattgaatgctgctagtaaagtatcaaga
aatggggttttatacactaatgtgcccccaaaatatgaacaagagtttgatagaaacact
cattaccaatatccaatcaaatcatcgtttcatcaagatattcaaattattgttccaatt
tataaaccaggtagttataattattatattgaatatgatgatgaagaagataataagaaa
accactgagaaatattacttcaatgtccccccaaatttaacgatcaatggtaaatttgtt
cccttcaataacattaatgttgaaactgtggtttccaaatggattggaccttatgagaat
tgggacaagtttttcaagattgtggcacaaaaggggtataatatgattcattttactcca
ttgcaagaacgtggtgaatcggattccccttattcgatctatgatcaattgaagtttgat
cctaagattttccctggtagtgatcaagattctatacaaaaaatccataaagtattgaat
gataatcaattgttgtcattgaccgatgtggtttggaatcatactgccaataattctgaa
tggttgagagaacatccagattcaggttataatgccaccactgcccctcatttgatccct
gctattgaattggatgaaacattgttagagtattctcataatttacaagaattaggttta
ccaactgttctcgaatcagaagcagatttacaaaaagttatggatggtattcaaactcat
gtgttggagaaattaaaattgtgggaatattatgttttccataaaagacaaacaatcatt
gatttggaaaaatcttttaaagccaacaaaaacaatatcaatagaattcaaattcctaat
gatgttgatcctcaaaacttgaaacaattgagtgattatgttttaaaagtggctaatatc
aacccaactcctattatagccgatagatttgccaacaaattgaatgttgataaactttta
gaggttttgtttacagtatttgatggtaatgttgaatttgaaaccattgctgacaaggca
gaagaaattattgatgtgattaatagtgatttatatgcgttatttgatgatgataccagt
agtatcaaacaacaaattgctgatcgtattaaatatttgagattagctgataatggtcct
aaattaggtgaaatcactgataaatctcctttaaccgaaccatatttcaccagattcacc
gatgttaatggcaagaagcaagctttagccaataatggttggatttggggaggtaatcca
ttagttgattttgcatctaataaatcaagagcttatattcgtcgagaagttattgtttgg
ggtgattgtgttaaattaagatatggtgaaaaatttgaagattctccagaaacttggaaa
cgtatgattgaatatactcaattatcagcgaaaacatttaatgggtttagaattgataat
tgtcatagtacaccattacatgttggtgaaagattattagatgaagccaggaaagttaat
cctaatctttatgtaattgctgaattgtttagtggttcagcagaaatggataaaatattt
gttgaaagattaggaatcaattcattgattagagaagcaatgcaagcatggagtgtaggt
gaattatctcgtttggttcataaacatggtggtagaccaattggttcattgacttggtta
ccattggatgattttacttatcctgctattaatgaacctatcaaggataaatatattgat
ggatataccgaattagaaatccccaaagttttaacttgtcaagctcctcatgcaattttt
atggattgtactcatgataatgagacaccagcacaaaagagaactgttgaagatacatta
cctaatgcggcattagtagcattttgttcatcagctgtggggtcagttttcggttatgat
gaatgttatcctaaattgttaaatgttgttagtgaaacaagacattatgatcttgatagt
gacaatggtattggagaaattaagggtaaattgaataaaattagagataatcttgttcaa
gaaagtgaggatgtcactcgtgatcatgaaatgtatattcatcatgaaggacaatatatt
actattcaaaggtacaatgcaagaacaggtaatggatggtttttaattgccagaagcaaa
ttttctgaacatgaaccgacccaaggtttatcaccatcaattcttggtggaactaaagtt
aaacatgaatttagttacactttgaaaaaacaaccaggtgattatgaaccacaatcggat
aaattgactggtattccagtaaaagtcgaatctattgaggatccatcgattgaatacact
gaagatggtgattcaataattactattgatgaaaatatattcattcctggatctattgct
gttttctctaccgagattcctggagttgatgtgaaattagataattttgtgaaacaagga
gctattgaagcatcaattggattagatttatatgatttaaatgctttattatatcgtgct
tccactgaagaattggatgctagtcatggtaaagatgatgtatatgatattcctggatat
gggaaattaacatatgctggattagaaggatggaatacggcattaaaacatgttatttgg
caaaataatttgggacatccaatttgtgatcatttacgaaatggtgattgggcttttgat
tatgttattaatcgattagataaatatgttgttaaactggaaaatttattaaaattccaa
gattggttacgatctcgatttgatgctgttaaaaatagtaaagcaccatattttttgcga
ccacattattttgctcttattatgggtattgcttatgaagcagctagatttagagttatt
agacaaatgagtgaagagattaaagaggccactaattttgttcaaagtcttgctcttact
tcagtacaaatggttgggtatatgcaaaatacttctttagtacccgataaacaagtccca
tgtatggcagctgggttacctcatttcagtaatgattatatgagatgttggggtagagat
gttttcattgcctttagagggttattaattgttactggtagatatgatgatgccaaacaa
catattttagggtttgccaagactttaaaacatggattaattcctaatttattagatgct
ggacgtaatcctcgttataatgctagagatgcagtatggtttttcttacaagccattcaa
gaatatgttacttatgttcctaatggtattaatattttggatgaaaaagtgactcgtaga
ttcccattagatgatacttatattccatatgatgatccacaagcttttagttatgaatct
tccattagagagattatttatgaaatattggctcgtcatgctaaaggtatcaaatatcgt
gaagccaatgctggaccaaatttggattcacaaatgaaagatgaagggtttaatgttgaa
attggagttgattggaataatggattaatttatggtggtaatcaatttaattgtggtact
tggatggataaaatgggtgaaagtgaaaaagctcataataaaggtattcccgggactcca
cgtgatggatcagccattgaaattcaaggattattaaagagtgcattaagatttgttaat
aaattacataaacaaggtaaatttgattataccaaagtgattaaacctgatggtactact
atttcattaaaagattgggaatcattacttggagaaaattttgagaaatattattatatt
cctaaagatcaacaacaagatgatcaatatattattgatccatcaattgttaatagaaga
ggaatttataaagatttatataattctgggaaaccatttgaagattatcaattacgacca
aattttgctattgccatgtgtgttgctcctgaattatttacaccagaaaaagctcttgaa
gctattataattgctgataaatctattcgaggacctataggtatgaaaacattggatcca
ttagattggaattatcgaccatattatgaaaattctattgataatgatgattttgctact
tcaaaaggtagaaattatcatcaaggaccagaatgggtttggaatactggatatttctta
agagcatttttattattccatcatttacatgaatcaaagacaaagagtttttcttttact
tcttcttcttcgttacttctgccatcaattaagattttgacattattgaatgatagatta
caaggacatataaaatggattaaagaaagtccatggaatggattaactgaattgactaat
aaagatggttcatattgtcaagattcaagtcctactcaagcatggagtggtagttgttta
ttagatttatattatgatctttggaatgataaacattttcaatag

DBGET integrated database retrieval system