KEGG   Candida dubliniensis: CD36_45560Help
Entry
CD36_45560        CDS       T01140                                 

Definition
histone deacetylase, putative
Orthology
K11482  
histone deacetylase HOS1 [EC:3.5.1.98]
Organism
cdu  Candida dubliniensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(1364662..1366020)
Genome map
AA seq 452 aa AA seqDB search
MYRNCVRLGVLSGSYCCSGLIISTLSCKIVPAKISIVYVIKNKNKKKNCQRPGHYYQTSK
MTTKRKVYITLSDSTTNIFDLLPSNKGRQSLVQGLIEAYKLIDLCDGTIHIYPAQTKDLT
TYHDEEFVKHLMEPRTSLDKYSDQIDAGEADLTNVVIEENDLDEKYGLVFDCYPFPCLGL
YVSLTAASSINAARKIVQQVKETNYQIIAVNWYGGRHHCHKSQAAGFCYVNDVVLSINIL
RKNLGPVFYLDLDLHHGDGVESAFKFSKKVATCSIHRYDVGFYPGTGSLKSSRENTYNIP
TGKGLNNSSMLWIIKEIVTPLIVNFGPKAIVIQCGCDGLALDTHKEWNMTIKGYRNSIEW
IINYFSEIPIMLLGGGGYNHTETAKCWTYLTGSVLRVSNIDTWDIIPEHKNLDAYEEDGF
RFWTDHNTGPSKMKDHNSVEYLNEIKAHLLSL
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgtataggaattgtgtaagacttggtgtattatctggatcatattgctgtagtggttta
attatctctacccttctgtgtaaaatagttcccgcaaaaatactgattgtttatgtaatc
aaaaacaaaaacaaaaaaaaaaactgccaaagaccaggccattattatcaaacactgaag
atgaccacaaagagaaaagtgtatatcactctatcagactctacaaccaatatatttgat
ttacttccatctaataagggaaggcagtcgttagtacaaggcctaattgaggcttataaa
ttgattgacttgtgtgatggaactatacatatttatccagctcagactaaagatcttacg
acgtatcatgatgaagagtttgttaaacatttgatggaacctcgaacgtctctagataaa
tattccgatcaaattgacgcaggagaagcagatttaacaaatgttgtaattgaggaaaat
gatctagatgagaaatatggattagttttcgattgttatccattcccatgtttgggctta
tatgtgctgttgacggcagcatctagtataaatgctgcgagaaagatagttcaacaagtt
aaagaaactaattatcaaataattgcagtgaattggtatggaggaagacaccattgtcac
aaatctcaagcagctgggttctgttatgtgaatgatgtggtgctatcaattaacattcta
cgtaaaaacttgggtccggtgttttatcttgatttggatttgcatcatggagatggagta
gaaagcgcttttaagttttccaagaaagttgctacttgttcaatacatagatatgatgtt
ggattttatcctggtactgggagtttgaaaagctctcgagaaaatacatacaatatacca
actgggaagggactaaacaattcaagtatgttatggataatcaaagaaattgtaactccg
ttgatagtcaattttggcccaaaggctattgtcattcaatgtgggtgtgatggattggct
ctagatacacataaggaatggaatatgaccattaaggggtatcgtaatagtatagagtgg
ataataaattattttagtgaaatacctataatgttgttaggtggcggaggatacaatcat
acagagactgcaaaatgctggacatacctcacaggtctggttctacgagttagtaatatt
gatacatgggatatcataccagaacacaaaaatttagatgcatatgaagaagatggtttc
agattctggacagaccataatacaggccctagtaaaatgaaagatcacaatagtgtagaa
tatttgaatgaaattaaagctcatttattgtctctataa

DBGET integrated database retrieval system