KEGG   Candida dubliniensis: CD36_45650Help
Entry
CD36_45650        CDS       T01140                                 

Definition
(RefSeq) tryptophan synthase, putative
  KO
K01694  tryptophan synthase [EC:4.2.1.20]
Organism
cdu  Candida dubliniensis
Pathway
cdu00260  Glycine, serine and threonine metabolism
cdu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cdu01100  Metabolic pathways
cdu01110  Biosynthesis of secondary metabolites
cdu01130  Biosynthesis of antibiotics
cdu01230  Biosynthesis of amino acids
Module
cdu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CD36_45650
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CD36_45650
Enzymes [BR:cdu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CD36_45650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PALP
Motif
Other DBs
NCBI-GeneID: 8047991
NCBI-ProteinID: XP_002420208
UniProt: B9WGQ5
Position
4:complement(1391215..1393323)
Genome map
AA seq 702 aa AA seqDB search
MSALLKETFARCKKEGRNALVNFITAGFPTIDDTIPILQNMQNAGVDIIELGVPFSDPIA
DGPTIQQANNVALDNGITVPKCLELLSQARNQGVTVPIILMGYYNPILKYGEQKFLKDAE
EAGANGFIVVDLPPEEAIKFRTECTKYGLSYVPLVAPATSNERLKILGEIADSFIYVVSK
MGTTGASTKVSTGIQELCDRVRKYAGPDTPLAVGFGVSTREHFLTVGEVADGVVIGSKII
TLIGDSKPGERGKVAYDYVQSILGNDFKPTYPKTFERNNNNQAKETKPVLEENHKYNPRF
GDFGGQYVPEALHTCLAELEKGFEDAVADPEFWKEFRDLYSYIGRPSSLHRAERLSEHAG
GAQIWLKREDLNHTGSHKINNALAQVLIAKRLGKKKIIAETGAGQHGVATATACAKFGLE
CTVFMGAEDTRRQALNVFRMKILGANVVPVKNGTQTLRDATSEAFRFWVSNLETTHYVVG
SAIGPHPYPTLVRTFQSVIGQETKEQFKALNNGKLPNAVVACVGGGSNSTGMFSPFENDK
EVKLLGVEAGGDGLDTERHSATLTAGIPGVFHGVKTYVLQDNDGQVHDTHSVSAGLDYPG
VGPELAYWKSIGRAEFVAATDAQALEGFRLLSQLEGIIPALESSHAIYGAIELAKTMSKD
QHIVINVSGRGDKDVQSVAEVLPKLGEQIGWDLRFEEDPSKA
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctttacttaaagaaacatttgccagatgcaaaaaggaaggacgcaatgcctta
gttaattttatcactgctgggttccctaccattgacgataccattcctattttacagaac
atgcaaaatgccggtgttgatatcattgaattaggtgttccattttctgatcctattgct
gacggtcctaccattcaacaagccaacaatgttgccttagataacggaatcactgttcct
aaatgtttagaattattatctcaagccagaaatcaaggtgtcaccgtaccaattatttta
atggggtattataatccaattttgaaatatggtgaacagaaatttttgaaagatgcagaa
gaagctggtgccaatgggtttattgtggtcgatttacctcccgaagaagcaattaaattt
agaaccgaatgtaccaaatatggattatcttatgttccattagttgctcctgctacttca
aatgaaagattgaaaattttaggagaaattgccgactcatttatttatgttgtttctaaa
atgggtaccactggtgcttcaactaaagtttcaacggggatccaagaattatgtgataga
gtgagaaaatatgccggaccggatactccattagccgttggctttggggtttccactaga
gaacattttttgaccgttggtgaagttgccgatggtgtagttattggatcgaaaattatc
actttgattggtgattccaaaccaggcgaaagaggtaaagttgcttatgattacgtccaa
tctattttgggaaatgatttcaaacctacttatcctaaaacatttgaaagaaataacaat
aaccaagctaaggaaactaaaccagttttggaagagaatcataaatacaatccaagattt
ggtgatttcggtggtcaatatgtccctgaagcattacatacatgtttagctgaattagaa
aaagggtttgaagatgccgttgctgatcctgaattttggaaagaatttagagatttatat
tcatacattggaagaccatcatctttacacagggcagaaagattatctgaacatgcaggt
ggagcacaaatttggttgaaaagagaagatttgaatcatactggttctcataaaatcaac
aatgccttggctcaagttttaattgccaagagattaggtaaaaagaaaatcattgctgaa
actggtgctggtcaacatggtgttgccactgctactgcttgtgccaagtttggattggaa
tgtacggtatttatgggagctgaagatactagacgtcaagcattaaatgttttcagaatg
aaaattttgggtgctaatgttgtccctgtaaaaaatgggactcaaactttaagagatgcc
acctctgaagcttttagattttgggtatccaatttagaaactactcattacgttgttgga
tcagcaattggtcctcatccatatcctactttggttagaactttccaaagtgttattggt
caagaaactaaagaacaattcaaagctttaaacaatgggaaattgcccaatgcagttgtt
gcttgtgttggtggtggatccaattccaccggtatgttctctcctttcgaaaatgataaa
gaagttaaattattaggggttgaagctggtggtgatggtttggatactgaacgtcactct
gctactttaacagccggtattcctggtgttttccatggggttaagacttatgttttacaa
gataatgacggtcaagttcatgatactcattctgtatctgccggattggattatcctggt
gttggtccagaattggcttattggaagagtattggtagagctgagtttgttgctgctact
gatgcacaagctttggaagggttcagattattatcgcaattggaaggtattattcctgct
ttggaaagctctcatgctatttatggtgctattgaattggctaaaacaatgtctaaagac
caacatattgttattaacgtatctggtagaggtgataaagatgttcaatcagttgctgaa
gtattgcctaaattgggtgaacaaattggctgggacttgagatttgaagaagatccttca
aaagcttag

DBGET integrated database retrieval system