KEGG   Candida dubliniensis: CD36_45650Help
Entry
CD36_45650        CDS       T01140                                 

Definition
tryptophan synthase, putative
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
cdu  Candida dubliniensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CD36_45650
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CD36_45650
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CD36_45650
Enzymes [BR:cdu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CD36_45650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(1391215..1393323)
Genome map
AA seq 702 aa AA seqDB search
MSALLKETFARCKKEGRNALVNFITAGFPTIDDTIPILQNMQNAGVDIIELGVPFSDPIA
DGPTIQQANNVALDNGITVPKCLELLSQARNQGVTVPIILMGYYNPILKYGEQKFLKDAE
EAGANGFIVVDLPPEEAIKFRTECTKYGLSYVPLVAPATSNERLKILGEIADSFIYVVSK
MGTTGASTKVSTGIQELCDRVRKYAGPDTPLAVGFGVSTREHFLTVGEVADGVVIGSKII
TLIGDSKPGERGKVAYDYVQSILGNDFKPTYPKTFERNNNNQAKETKPVLEENHKYNPRF
GDFGGQYVPEALHTCLAELEKGFEDAVADPEFWKEFRDLYSYIGRPSSLHRAERLSEHAG
GAQIWLKREDLNHTGSHKINNALAQVLIAKRLGKKKIIAETGAGQHGVATATACAKFGLE
CTVFMGAEDTRRQALNVFRMKILGANVVPVKNGTQTLRDATSEAFRFWVSNLETTHYVVG
SAIGPHPYPTLVRTFQSVIGQETKEQFKALNNGKLPNAVVACVGGGSNSTGMFSPFENDK
EVKLLGVEAGGDGLDTERHSATLTAGIPGVFHGVKTYVLQDNDGQVHDTHSVSAGLDYPG
VGPELAYWKSIGRAEFVAATDAQALEGFRLLSQLEGIIPALESSHAIYGAIELAKTMSKD
QHIVINVSGRGDKDVQSVAEVLPKLGEQIGWDLRFEEDPSKA
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctttacttaaagaaacatttgccagatgcaaaaaggaaggacgcaatgcctta
gttaattttatcactgctgggttccctaccattgacgataccattcctattttacagaac
atgcaaaatgccggtgttgatatcattgaattaggtgttccattttctgatcctattgct
gacggtcctaccattcaacaagccaacaatgttgccttagataacggaatcactgttcct
aaatgtttagaattattatctcaagccagaaatcaaggtgtcaccgtaccaattatttta
atggggtattataatccaattttgaaatatggtgaacagaaatttttgaaagatgcagaa
gaagctggtgccaatgggtttattgtggtcgatttacctcccgaagaagcaattaaattt
agaaccgaatgtaccaaatatggattatcttatgttccattagttgctcctgctacttca
aatgaaagattgaaaattttaggagaaattgccgactcatttatttatgttgtttctaaa
atgggtaccactggtgcttcaactaaagtttcaacggggatccaagaattatgtgataga
gtgagaaaatatgccggaccggatactccattagccgttggctttggggtttccactaga
gaacattttttgaccgttggtgaagttgccgatggtgtagttattggatcgaaaattatc
actttgattggtgattccaaaccaggcgaaagaggtaaagttgcttatgattacgtccaa
tctattttgggaaatgatttcaaacctacttatcctaaaacatttgaaagaaataacaat
aaccaagctaaggaaactaaaccagttttggaagagaatcataaatacaatccaagattt
ggtgatttcggtggtcaatatgtccctgaagcattacatacatgtttagctgaattagaa
aaagggtttgaagatgccgttgctgatcctgaattttggaaagaatttagagatttatat
tcatacattggaagaccatcatctttacacagggcagaaagattatctgaacatgcaggt
ggagcacaaatttggttgaaaagagaagatttgaatcatactggttctcataaaatcaac
aatgccttggctcaagttttaattgccaagagattaggtaaaaagaaaatcattgctgaa
actggtgctggtcaacatggtgttgccactgctactgcttgtgccaagtttggattggaa
tgtacggtatttatgggagctgaagatactagacgtcaagcattaaatgttttcagaatg
aaaattttgggtgctaatgttgtccctgtaaaaaatgggactcaaactttaagagatgcc
acctctgaagcttttagattttgggtatccaatttagaaactactcattacgttgttgga
tcagcaattggtcctcatccatatcctactttggttagaactttccaaagtgttattggt
caagaaactaaagaacaattcaaagctttaaacaatgggaaattgcccaatgcagttgtt
gcttgtgttggtggtggatccaattccaccggtatgttctctcctttcgaaaatgataaa
gaagttaaattattaggggttgaagctggtggtgatggtttggatactgaacgtcactct
gctactttaacagccggtattcctggtgttttccatggggttaagacttatgttttacaa
gataatgacggtcaagttcatgatactcattctgtatctgccggattggattatcctggt
gttggtccagaattggcttattggaagagtattggtagagctgagtttgttgctgctact
gatgcacaagctttggaagggttcagattattatcgcaattggaaggtattattcctgct
ttggaaagctctcatgctatttatggtgctattgaattggctaaaacaatgtctaaagac
caacatattgttattaacgtatctggtagaggtgataaagatgttcaatcagttgctgaa
gtattgcctaaattgggtgaacaaattggctgggacttgagatttgaagaagatccttca
aaagcttag

DBGET integrated database retrieval system