KEGG   Candida dubliniensis: CD36_45650Help
Entry
CD36_45650        CDS       T01140                                 

Definition
(RefSeq) tryptophan synthase, putative
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
cdu  Candida dubliniensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CD36_45650
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CD36_45650
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CD36_45650
Enzymes [BR:cdu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CD36_45650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(1391215..1393323)
Genome map
AA seq 702 aa AA seqDB search
MSALLKETFARCKKEGRNALVNFITAGFPTIDDTIPILQNMQNAGVDIIELGVPFSDPIA
DGPTIQQANNVALDNGITVPKCLELLSQARNQGVTVPIILMGYYNPILKYGEQKFLKDAE
EAGANGFIVVDLPPEEAIKFRTECTKYGLSYVPLVAPATSNERLKILGEIADSFIYVVSK
MGTTGASTKVSTGIQELCDRVRKYAGPDTPLAVGFGVSTREHFLTVGEVADGVVIGSKII
TLIGDSKPGERGKVAYDYVQSILGNDFKPTYPKTFERNNNNQAKETKPVLEENHKYNPRF
GDFGGQYVPEALHTCLAELEKGFEDAVADPEFWKEFRDLYSYIGRPSSLHRAERLSEHAG
GAQIWLKREDLNHTGSHKINNALAQVLIAKRLGKKKIIAETGAGQHGVATATACAKFGLE
CTVFMGAEDTRRQALNVFRMKILGANVVPVKNGTQTLRDATSEAFRFWVSNLETTHYVVG
SAIGPHPYPTLVRTFQSVIGQETKEQFKALNNGKLPNAVVACVGGGSNSTGMFSPFENDK
EVKLLGVEAGGDGLDTERHSATLTAGIPGVFHGVKTYVLQDNDGQVHDTHSVSAGLDYPG
VGPELAYWKSIGRAEFVAATDAQALEGFRLLSQLEGIIPALESSHAIYGAIELAKTMSKD
QHIVINVSGRGDKDVQSVAEVLPKLGEQIGWDLRFEEDPSKA
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctttacttaaagaaacatttgccagatgcaaaaaggaaggacgcaatgcctta
gttaattttatcactgctgggttccctaccattgacgataccattcctattttacagaac
atgcaaaatgccggtgttgatatcattgaattaggtgttccattttctgatcctattgct
gacggtcctaccattcaacaagccaacaatgttgccttagataacggaatcactgttcct
aaatgtttagaattattatctcaagccagaaatcaaggtgtcaccgtaccaattatttta
atggggtattataatccaattttgaaatatggtgaacagaaatttttgaaagatgcagaa
gaagctggtgccaatgggtttattgtggtcgatttacctcccgaagaagcaattaaattt
agaaccgaatgtaccaaatatggattatcttatgttccattagttgctcctgctacttca
aatgaaagattgaaaattttaggagaaattgccgactcatttatttatgttgtttctaaa
atgggtaccactggtgcttcaactaaagtttcaacggggatccaagaattatgtgataga
gtgagaaaatatgccggaccggatactccattagccgttggctttggggtttccactaga
gaacattttttgaccgttggtgaagttgccgatggtgtagttattggatcgaaaattatc
actttgattggtgattccaaaccaggcgaaagaggtaaagttgcttatgattacgtccaa
tctattttgggaaatgatttcaaacctacttatcctaaaacatttgaaagaaataacaat
aaccaagctaaggaaactaaaccagttttggaagagaatcataaatacaatccaagattt
ggtgatttcggtggtcaatatgtccctgaagcattacatacatgtttagctgaattagaa
aaagggtttgaagatgccgttgctgatcctgaattttggaaagaatttagagatttatat
tcatacattggaagaccatcatctttacacagggcagaaagattatctgaacatgcaggt
ggagcacaaatttggttgaaaagagaagatttgaatcatactggttctcataaaatcaac
aatgccttggctcaagttttaattgccaagagattaggtaaaaagaaaatcattgctgaa
actggtgctggtcaacatggtgttgccactgctactgcttgtgccaagtttggattggaa
tgtacggtatttatgggagctgaagatactagacgtcaagcattaaatgttttcagaatg
aaaattttgggtgctaatgttgtccctgtaaaaaatgggactcaaactttaagagatgcc
acctctgaagcttttagattttgggtatccaatttagaaactactcattacgttgttgga
tcagcaattggtcctcatccatatcctactttggttagaactttccaaagtgttattggt
caagaaactaaagaacaattcaaagctttaaacaatgggaaattgcccaatgcagttgtt
gcttgtgttggtggtggatccaattccaccggtatgttctctcctttcgaaaatgataaa
gaagttaaattattaggggttgaagctggtggtgatggtttggatactgaacgtcactct
gctactttaacagccggtattcctggtgttttccatggggttaagacttatgttttacaa
gataatgacggtcaagttcatgatactcattctgtatctgccggattggattatcctggt
gttggtccagaattggcttattggaagagtattggtagagctgagtttgttgctgctact
gatgcacaagctttggaagggttcagattattatcgcaattggaaggtattattcctgct
ttggaaagctctcatgctatttatggtgctattgaattggctaaaacaatgtctaaagac
caacatattgttattaacgtatctggtagaggtgataaagatgttcaatcagttgctgaa
gtattgcctaaattgggtgaacaaattggctgggacttgagatttgaagaagatccttca
aaagcttag

DBGET integrated database retrieval system