KEGG   Candida dubliniensis: CD36_45970Help
Entry
CD36_45970        CDS       T01140                                 

Gene name
CEK1
Definition
ERK-family protein kinase, putative
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
cdu  Candida dubliniensis
Brite
Enzymes [BR:cdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CD36_45970 (CEK1)
Protein kinases [BR:cdu01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CD36_45970 (CEK1)
Exosome [BR:cdu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CD36_45970 (CEK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(1472966..1474219)
Genome map
AA seq 417 aa AA seqDB search
MMNIDQHHQLQQQHQHQQQMLQQQQQAQAQVQAQQQAQQQAAAAAAATTAANAAAAAGAT
SSTTPRQVSFNVSDHYQILEIVGEGAYGIVCSAIHKPSQQKVAIKKIEPFERSMLCLRTL
RELKLLKHFNHENIISILAIQRPINYELFNEIYLIQELMETDLHRVIRSQNLSDDHIQYF
IYQTLRALKAMHSANILHRDLKPSNLLLNSNCDLKICDFGLARSIASQEDNYGFMTEYVA
TRWYRAPEIMLTFQEYTTAIDVWSVGCILAEMLNGRPLFPGRDYHNQLWLIMEVLGTPNM
EDYYNIKSKRAREYIRSLPFCKKIPFNELFANNNSSNKNINPLALDLLEKLLIFNPIKRI
TVEDALKHPYLQLYHDPNDEPISNKIPEDFFDFDKKKDQLSIEDLKKLLYEEIMKPL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatatagatcaacatcatcagcttcaacaacaacatcaacatcaacaacaaatg
ttacaacaacaacaacaggctcaagcacaggtacaggctcaacaacaggctcaacaacag
gcagcagcagcagcagcagcaacaacagcagctaacgctgctgctgctgctggtgctact
tcttctactactcctcgtcaagtatcattcaatgtttctgatcattatcaaattttagaa
attgttggagaaggagcttatggtatagtttgttcagctattcataaaccttcacaacaa
aaagttgctattaaaaaaattgaaccatttgaaagaagtatgttatgtttaagaacttta
agagaattaaaattattaaaacattttaatcatgaaaatattattagtatattagcaatt
caaagaccaattaattatgaattatttaatgaaatttatttaattcaagaattaatggaa
actgatttacatcgagttatacgaagtcaaaatttatctgatgatcatatacaatatttt
atttatcaaactttaagagctcttaaagctatgcattcagctaatatattacatcgagat
ttaaaacctctgaatttattattaaattcaaattgtgatttaaaaatttgtgattttggt
ttagcaagatcaattgcttcacaagaagataattatggatttatgacagaatatgttgct
actagatggtatagagctccagaaattatgttaactttccaagaatatacaacagcaatt
gatgtttggtcagtaggttgtatattagcagaaatgttaaatggtagacctttattccct
ggtagagattatcataatcaattatggttaattatggaagttttaggtactcctaatatg
gaagattattataatattaaatctaaacgagcaagagaatatattagaagtttaccattt
tgtaaaaaaatcccttttaatgaattatttgccaataacaatagtagtaacaagaatatt
aatcctttagcattagatttattagaaaaattattaatttttaatcctattaaaagaatt
actgttgaagatgctttaaaacatccttatttacaattatatcatgatcctaatgatgaa
ccaattagtaataaaattcctgaagattttttcgattttgataaaaaaaaagatcaatta
tcaattgaagatttaaaaaaattgttatatgaagaaattatgaaaccattatag

DBGET integrated database retrieval system