KEGG   Candida dubliniensis: CD36_51470Help
Entry
CD36_51470        CDS       T01140                                 

Definition
cytochrome c peroxidase, mitochondrial precursor, putative (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cdu  Candida dubliniensis
Brite
Enzymes [BR:cdu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     CD36_51470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:370448..371323
Genome map
AA seq 291 aa AA seqDB search
MIRSYIKNIILAILSPLLITTPPLVLPPPYEKIIQEIITVFSVDNYDDGSLAPIILRLAW
HCCATYDVTTNTGGSNGATMRFVPEITDEGNYGLDVARAALEPIKQRYPTISYADLWTLA
GKVAIEHMGGPTIIWKSGRVDYTNDQDVPPNGLLPFADKNANHVRKTFTRLGFNDRETVA
LIGAHGVGRCHKRFSGWEGKWTSIPKTFSNQFYVVLLNEIWSQGEVPETGKTQYFNADKS
LIMLNTDMELIRDKSYLRWVEIYAKDEPRFLHDFSAAFAKLLELGIKREPF
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgattcgaagttatatcaaaaatatcatacttgccattctatcacctttactaatcacc
acacccccacttgtccttcctcctccatatgagaaaataattcaggaaatcatcacagtg
ttctccgttgataattacgacgacggttcgttggcgcctattatccttcgtcttgcttgg
cattgttgtgctacatatgatgtgactaccaacactggcgggtctaacggtgctacaatg
agatttgttcctgaaataactgacgaagggaactatgggttagacgttgctcgtgctgca
ttagaaccaataaaacaacgatacccaacaatttcgtatgctgacttgtggacattggca
ggaaaagttgcaatagaacatatgggcggtcctacaattatctggaaaagtggcagagtt
gattatacaaacgatcaagatgtcccacctaatgggttgttgccgtttgctgacaaaaat
gcaaaccacgtacgaaaaacatttacaagattaggatttaatgatcgggaaacggtagct
ctaataggtgctcatggtgtaggtagatgtcacaaacggttcagtggttgggaaggtaaa
tggaccagcatccccaaaaccttctcaaaccaattttatgtggtgttacttaatgaaata
tggagtcagggtgaagtcccggaaactggcaaaacacaatactttaatgctgataaatca
ctaataatgctaaacaccgacatggagttgattagagataagtcgtacttgcgttgggtt
gaaatttatgcaaaagatgaaccaaggtttttgcacgacttttccgccgctttcgcaaaa
ttattagagttagggataaaacgggaaccgttctaa

DBGET integrated database retrieval system