KEGG   Candida dubliniensis: CD36_51690Help
Entry
CD36_51690        CDS       T01140                                 

Definition
folic acid synthesis protein, putative [includes: dihydroneopterin aldolase ; dihydro-6-hydroxymethylpterin-pyrophosphokinase ; dihydropteroate synthetase (EC:2.7.6.3 2.5.1.15 4.1.2.25)
Orthology
K13939  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:4.1.2.25 2.7.6.3 2.5.1.15]
Organism
cdu  Candida dubliniensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CD36_51690
Enzymes [BR:cdu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CD36_51690
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     CD36_51690
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     CD36_51690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(436170..438572)
Genome map
AA seq 800 aa AA seqDB search
MLKNDTVFTKEISCTAITGKDAWNRPTPQPITISLSFNTDFHKASELDNLKYSINYAVIT
RNVTEFMKSNEHLNFKSLGNIAQAISDIGLDQSRGGGSIVDVTIKSSKSEIRAESVEYKI
NRNILDQPIPLDIFQVNKLRLLTIIGVFTFERLQKQIVDVDLQFKIEPNSNLYFHQIIAD
IVSYVESSNFKTVEALVSKIGQLTFQKYREGIAEVVATVTKPNAFSHVEGVGVSSTMVKG
NFQNMEPIKFDNMIAQTNNSTFNLPVENEKTDDYTGYHTAFIAFGSNTGNQVENINNSFE
LLKEYGITIETTSSLYISKPMYYLDQPDFFNGVIKVNFQNISPFQLLKILKEIEYKHLER
EKEFDNGPRSIDLDIILYDDLQLNTENLIIPHKSMLERTFVLQPLCEVLPPDYIHPISAE
SLHSHLQQLINDKPQESVQESSDLLQFIPVSRLPVKDNILKFDQINHKSPTLIMGILNMT
PDSFSDGGKYLGKESDNIVKQAEKLVSEGATIIDIGGVSTRPGSVEPSEEEELQRVIPLI
KAIRHQSSNSDLSKVLISVDTYRSNVAEQSLLAGADIINDISMGKYDEKIFDVVAKYGCP
YIMNHTRGSPKTMSKLTNYESNTNDDIIEYIIDPKLGHQELELSPEIKNLLNGISRELSL
QMFKAMAKGVKKWQIILDPGIGFAKNLNQNLAVIRNASFFKKYSIQINERVDDDDDDDDD
DDVTIEHKYLSFNGACVLVGASRKKFLGELTGNEVPSERVFATGATISACIEQNTDIVRV
HDVKEMKDVVCISDAIYKNV
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaaacgatactgtgttcactaaagaaatttcttgtacggcaataacaggtaaa
gatgcctggaatcgaccaacacctcaaccaattaccatatcattatcattcaatactgat
tttcataaggcatctgaattggataatttaaaatattcaattaattatgctgttattacg
agaaatgtaactgaatttatgaaatcaaatgaacatttaaatttcaaatcattgggtaac
attgctcaagctattagtgatattggattagatcaatctagaggtggtggatctattgtt
gatgtaacgataaaaagtctgaaatcggaaattcgagctgaaagtgttgaatataaaatt
aatagaaacattttggatcaaccaattccattagatattttccaagttaataaattgaga
ttattgactattattggggtttttacatttgaaagattacaaaagcaaattgttgatgtt
gatttacaattcaaaattgaacccaattccaatttatatttccatcaaataattgctgac
attgtttcatatgtggaatcatctaattttaaaactgtagaagcattggtatctaagatt
ggtcaattgacattccaaaaatatagggaggggatagctgaagttgttgctacagttacc
aagccaaatgcttttagtcatgttgaaggtgttggggtatcatctactatggtaaaaggc
aatttccaaaatatggagccaattaaatttgataacatgattgctcaaactaataatagt
acatttaatttaccagttgaaaatgagaaaaccgatgattataccgggtatcatactgca
tttattgcctttggatccaatactgggaatcaagtagaaaatatcaataattcatttgaa
ttattaaaagaatatggaattacaatagaaacaacttcatcattatacatttctaaacca
atgtattacttggatcaaccagattttttcaatggagtaattaaagtcaattttcaaaac
atttcacctttccaattattgaaaattttaaaagagattgaatataaacatttggaaagg
gaaaaagagtttgataatggtcctagatcaatagatttggatattatattatatgatgat
ttacaattgaatacggaaaatctaatcattcctcataaatcaatgttagaaagaacattt
gtattacaaccattatgtgaagtattacccccagattatattcatcccatcagtgcagaa
agtttgcatagtcatttacaacaattgataaatgataaacctcaagaatcagtacaagaa
tcgtcggatttattgcaatttatcccagtttctagactacctgttaaagataatatattg
aaatttgaccaaattaaccataaatctcctactttgattatgggtatattgaacatgact
cctgattcatttagtgatggtggtaagtatttaggtaaagaactggacaatattgtgaag
caggcagagaaattagttagtgaaggtgccaccattatagatattggaggggtctccact
cgaccaggaagtgttgaacccagtgaggaagaagaattacaacgagtaattccattaatc
aaagctattcgtcatcaatcgctgaattctgatttactgaaagtgttgatttctgttgat
acttatcgtagtaacgttgccgaacaaagtttacttgcgggtgccgatataatcaacgat
atatcaatgggcaagtatgatgaaaaaatctttgatgtagttgccaaatatggatgtccc
tatattatgaatcatactcgaggatccccgaaaaccatgtctaaattgactaattatgaa
tccaatacaaatgatgatattattgaatatataattgatcctaaattaggacatcaagaa
ttagaattgtcaccagaaatcaaaaatttacttaatgggatcagtcgtgaattgagttta
caaatgtttaaagcaatggctaaaggagtgaaaaaatggcaaataattttggatccaggg
attgggtttgccaaaaatttgaatcagaatttagcagttattcgtaatgcttcatttttt
aagaaatattctattcaaattaatgaacgtgttgatgatgatgatgatgatgatgatgat
gatgatgttacaatagaacataaatatttaagttttaatggtgcttgtgtcttggtgggg
gcatcacgaaagaagtttttgggggaattaactggtaatgaagtgcctctggaacgagta
tttgctactggtgcaactatatcggcatgtattgaacaaaataccgatattgttagagtg
catgacgttaaagaaatgaaagatgttgtttgtataagtgatgcaatttataaaaatgta
taa

DBGET integrated database retrieval system