KEGG   Candida dubliniensis: CD36_51690Help
Entry
CD36_51690        CDS       T01140                                 

Definition
folic acid synthesis protein, putative [includes: dihydroneopterin aldolase ; dihydro-6-hydroxymethylpterin-pyrophosphokinase ; dihydropteroate synthetase (EC:2.7.6.3 2.5.1.15 4.1.2.25)
Orthology
K13939  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:4.1.2.25 2.7.6.3 2.5.1.15]
Organism
cdu  Candida dubliniensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cdu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(436170..438572)
Genome map
AA seq 800 aa AA seqDB search
MLKNDTVFTKEISCTAITGKDAWNRPTPQPITISLSFNTDFHKASELDNLKYSINYAVIT
RNVTEFMKSNEHLNFKSLGNIAQAISDIGLDQSRGGGSIVDVTIKSSKSEIRAESVEYKI
NRNILDQPIPLDIFQVNKLRLLTIIGVFTFERLQKQIVDVDLQFKIEPNSNLYFHQIIAD
IVSYVESSNFKTVEALVSKIGQLTFQKYREGIAEVVATVTKPNAFSHVEGVGVSSTMVKG
NFQNMEPIKFDNMIAQTNNSTFNLPVENEKTDDYTGYHTAFIAFGSNTGNQVENINNSFE
LLKEYGITIETTSSLYISKPMYYLDQPDFFNGVIKVNFQNISPFQLLKILKEIEYKHLER
EKEFDNGPRSIDLDIILYDDLQLNTENLIIPHKSMLERTFVLQPLCEVLPPDYIHPISAE
SLHSHLQQLINDKPQESVQESSDLLQFIPVSRLPVKDNILKFDQINHKSPTLIMGILNMT
PDSFSDGGKYLGKESDNIVKQAEKLVSEGATIIDIGGVSTRPGSVEPSEEEELQRVIPLI
KAIRHQSSNSDLSKVLISVDTYRSNVAEQSLLAGADIINDISMGKYDEKIFDVVAKYGCP
YIMNHTRGSPKTMSKLTNYESNTNDDIIEYIIDPKLGHQELELSPEIKNLLNGISRELSL
QMFKAMAKGVKKWQIILDPGIGFAKNLNQNLAVIRNASFFKKYSIQINERVDDDDDDDDD
DDVTIEHKYLSFNGACVLVGASRKKFLGELTGNEVPSERVFATGATISACIEQNTDIVRV
HDVKEMKDVVCISDAIYKNV
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaaacgatactgtgttcactaaagaaatttcttgtacggcaataacaggtaaa
gatgcctggaatcgaccaacacctcaaccaattaccatatcattatcattcaatactgat
tttcataaggcatctgaattggataatttaaaatattcaattaattatgctgttattacg
agaaatgtaactgaatttatgaaatcaaatgaacatttaaatttcaaatcattgggtaac
attgctcaagctattagtgatattggattagatcaatctagaggtggtggatctattgtt
gatgtaacgataaaaagtctgaaatcggaaattcgagctgaaagtgttgaatataaaatt
aatagaaacattttggatcaaccaattccattagatattttccaagttaataaattgaga
ttattgactattattggggtttttacatttgaaagattacaaaagcaaattgttgatgtt
gatttacaattcaaaattgaacccaattccaatttatatttccatcaaataattgctgac
attgtttcatatgtggaatcatctaattttaaaactgtagaagcattggtatctaagatt
ggtcaattgacattccaaaaatatagggaggggatagctgaagttgttgctacagttacc
aagccaaatgcttttagtcatgttgaaggtgttggggtatcatctactatggtaaaaggc
aatttccaaaatatggagccaattaaatttgataacatgattgctcaaactaataatagt
acatttaatttaccagttgaaaatgagaaaaccgatgattataccgggtatcatactgca
tttattgcctttggatccaatactgggaatcaagtagaaaatatcaataattcatttgaa
ttattaaaagaatatggaattacaatagaaacaacttcatcattatacatttctaaacca
atgtattacttggatcaaccagattttttcaatggagtaattaaagtcaattttcaaaac
atttcacctttccaattattgaaaattttaaaagagattgaatataaacatttggaaagg
gaaaaagagtttgataatggtcctagatcaatagatttggatattatattatatgatgat
ttacaattgaatacggaaaatctaatcattcctcataaatcaatgttagaaagaacattt
gtattacaaccattatgtgaagtattacccccagattatattcatcccatcagtgcagaa
agtttgcatagtcatttacaacaattgataaatgataaacctcaagaatcagtacaagaa
tcgtcggatttattgcaatttatcccagtttctagactacctgttaaagataatatattg
aaatttgaccaaattaaccataaatctcctactttgattatgggtatattgaacatgact
cctgattcatttagtgatggtggtaagtatttaggtaaagaactggacaatattgtgaag
caggcagagaaattagttagtgaaggtgccaccattatagatattggaggggtctccact
cgaccaggaagtgttgaacccagtgaggaagaagaattacaacgagtaattccattaatc
aaagctattcgtcatcaatcgctgaattctgatttactgaaagtgttgatttctgttgat
acttatcgtagtaacgttgccgaacaaagtttacttgcgggtgccgatataatcaacgat
atatcaatgggcaagtatgatgaaaaaatctttgatgtagttgccaaatatggatgtccc
tatattatgaatcatactcgaggatccccgaaaaccatgtctaaattgactaattatgaa
tccaatacaaatgatgatattattgaatatataattgatcctaaattaggacatcaagaa
ttagaattgtcaccagaaatcaaaaatttacttaatgggatcagtcgtgaattgagttta
caaatgtttaaagcaatggctaaaggagtgaaaaaatggcaaataattttggatccaggg
attgggtttgccaaaaatttgaatcagaatttagcagttattcgtaatgcttcatttttt
aagaaatattctattcaaattaatgaacgtgttgatgatgatgatgatgatgatgatgat
gatgatgttacaatagaacataaatatttaagttttaatggtgcttgtgtcttggtgggg
gcatcacgaaagaagtttttgggggaattaactggtaatgaagtgcctctggaacgagta
tttgctactggtgcaactatatcggcatgtattgaacaaaataccgatattgttagagtg
catgacgttaaagaaatgaaagatgttgtttgtataagtgatgcaatttataaaaatgta
taa

DBGET integrated database retrieval system