KEGG   Candida dubliniensis: CD36_52080Help
Entry
CD36_52080        CDS       T01140                                 

Definition
threonine synthase, putative (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cdu  Candida dubliniensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cdu01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cdu00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:cdu00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:529614..531146
Genome map
AA seq 510 aa AA seqDB search
MPSSSQVYRSTRSNQPEELSFEDVVMTGLAPDGGLYLPSSIPQLPNDFLTKWSDLSFNEL
AFEILRLYINENEIPNADLKDLIARSYSTFRSSEVTPLKKLNDNLYILELFHGPTYAFKD
VALQFVGNLFEYFLTRRNAQKDLTKQPKDIITVVGATSGDTGSAAIYGLRGKKDVSVFIL
YPTGRISPIQEEQMTTVEDGNVHTLSVNGTFDDCQDIVKQIFGDKEFNDKYHVGAVNSIN
WARILAQQTYYFYSYFQLQKQAKTTNKVRFVVPSGNFGDILAGYYAYRMGLPVDKLIIAT
NENDILDRFIKSGEYAKEQEVGVKATYSPAMDILISSNFERLLWYLIRDNVPEVNKSDEK
AGQLLNDWMKQLKEQGKFKVPAEVIDAARQVFDSQRVDNDTTVQTIKQVYDQSGDKYVID
PHTSVGVTTSYSFIAKDTEPTQYISLSTAHPAKFSEVVNKALDSFDGYSFDKDVLPAELK
ALSSKEKRIKLIDEASVEKVKQAIKDELKF
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgccttcttcatcacaagtttatagatctactagatctaaccaaccagaagagttatca
tttgaagatgttgttatgacggggttagcccccgatggtggattgtatttaccatcctct
atccctcaattacctaatgactttttaactaaatggtcagacttgtcatttaatgaatta
gcttttgaaatattaagattatatatcaatgagaatgaaatccctaatgcagatttaaaa
gatttgattgctagatcatattcaacattcagatcatcagaagtgactcctttgaaaaaa
ctcaatgacaatttatacattttagaattatttcatggtcctacctatgcattcaaagat
gttgctttacaatttgttggtaaccttttcgaatatttcttaaccagaagaaatgcgcaa
aaagatttgactaaacaaccaaaagatatcatcaccgttgttggtgccacttctggtgac
acaggatcagctgccatttatggattacgtggtaagaaagatgtctctgtatttatattg
tatcctactggaagaattagccctatacaagaagagcaaatgacaactgttgaagatggt
aatgtccataccttatcagtcaatggtacatttgatgattgtcaagatattgtcaaacaa
atatttggtgataaagaatttaatgataagtatcatgttggggccgtcaactctatcaat
tgggcaagaatcttagcgcaacaaacatactatttctattcttatttccaattacaaaaa
caagctaaaaccactaataaggttagatttgttgttccttcaggtaattttggagacatt
ttggctggttattatgcttacagaatgggattaccagttgacaaattgattattgccact
aacgaaaatgacatcttggacagatttataaaatcaggagaatatgccaaagagcaagaa
gttggtgttaaggcaacttattccccagcaatggatattttgatctcatcgaattttgaa
agattgttatggtacttgatcagagacaatgttcctgaagtcaacaagagtgatgaaaaa
gcaggtcaattgttgaacgattggatgaaacaattgaaagaacaaggcaaatttaaagtc
ccagctgaggtcattgatgctgcaagacaagttttcgattcacaaagagttgataatgat
accacggtgcaaaccatcaaacaggtatatgaccaatctggtgataaatatgtcattgat
cctcatacttctgttggagtcactacttcttattcatttattgctaaagatacagagcca
acccaatacatttctctttccacggctcatccagcaaaattctccgaagttgtcaataaa
gcccttgattcctttgatggttattcgtttgacaaagatgttttgccagcagaattgaaa
gccttgagcagtaaagagaagagaattaaattgattgacgaagctagtgttgaaaaagtc
aaacaagctattaaagacgaattgaagttttag

DBGET integrated database retrieval system