KEGG   Candida dubliniensis: CD36_53360Help
Entry
CD36_53360        CDS       T01140                                 

Gene name
HEX1
Definition
N-acetyl-beta glucosaminidase, putative (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
cdu  Candida dubliniensis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CD36_53360 (HEX1)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    CD36_53360 (HEX1)
   00603 Glycosphingolipid biosynthesis - globo series
    CD36_53360 (HEX1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    CD36_53360 (HEX1)
   00511 Other glycan degradation
    CD36_53360 (HEX1)
Enzymes [BR:cdu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CD36_53360 (HEX1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:861102..862790
Genome map
AA seq 562 aa AA seqDB search
MVFDKMIVFHLLLWLCNAIIHAAKVDILPAPQSIIWENDTAIIINPRLLRENTSCSLLED
AFSRTVSAIEKSKWRPFPIDDFENANGKDIKTSLVDIQVDDVTVDLQLGVNESYTLKINS
NGIKIHAATIWGALHGLVSLQQLIVYTCDDKYVVPSSVTISDFPKFKHRGLMIDSGRNFL
TVDSILEQIDIMSLSKMNSLHWHLVDSQSWPVALESYPHMIKDAYSNDEVYSKNDLKYIV
DYARSRGVRVIPEIDMPGHARAGWKQVDPTIVECADAFWSDAAVEPPPGQLNIESEKTYE
VISNVYNELSDIFVDDVFHVGNDELQEKCYSAQLSPNNTVTDLLRRYLKKTLPIFNKINH
RKLTMWDDVLLSDVSVDNIPSNITLQVWHEIGGVKNLTSRGYDVVVSSSDFLYLDCGYAG
WVTNDPRYVEIPENIDFNTGQGGSWCGPYKSYQRIYNFDFTANLTEAEKEHVLGAEAALW
SEQVDSTVLTTKIWPRTTALAELTWSGNKDRKGHHRGYEFTQRILNFREYLIKLGYNVSP
LVPKYCLLNPHACDLYKTPPVY
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttgataaaatgattgtttttcatttgcttctttggttgtgcaatgccatcatc
catgctgctaaggttgacatactccctgctccgcagtcaataatctgggaaaatgatact
gcaattattatcaatccgagattgttacgggaaaatacctcctgctcacttttggaggat
gcatttagtagaaccgtctcggcaatagaaaagctgaagtggcgaccattccccatcgat
gactttgagaacgcaaatggtaaagacattaaaacatctttggtagatatccaggtagat
gatgttacagtcgacttacaactcggagttaatgaatcctacaccttgaaaattaattca
aatggaattaagatacatgcagcaacaatctggggagcattacatggtttggttagtctc
caacaattgatagtttatacctgtgatgacaagtatgttgtacccctgtcagtgacaatt
tctgattttcccaaattcaaacatagagggttgatgattgattcagggaggaacttctta
acagtggattctatacttgaacaaatagatatcatgtcattgtcgaagatgaattcattg
cactggcatttggtggattcacaaagctggcctgtggcattggaaagttatccacacatg
ataaaggatgcttacagcaatgatgaagtttattccaagaacgacttaaagtatattgtt
gactatgctcgttcgagaggggtgcgcgtgattccagaaattgatatgcctgggcatgct
agagctggatggaaacaagttgacccaaccatagttgagtgtgcagatgcattttggagc
gacgctgctgttgaaccgccaccaggacaattaaacatcgagtcggagaaaacctatgaa
gtaatttctaatgtctacaatgaattatcagatatttttgttgatgatgtcttccacgtt
ggaaatgacgagcttcaagaaaaatgttattcggctcaacttctgccaaataatacagtt
acagatttgttaaggcgatacttaaagaaaacattaccaatttttaataagattaatcac
cgaaaactcactatgtgggatgacgttttactatctgatgtatcagtagataatatcccc
agcaacatcactttacaagtttggcatgaaattggtggagtcaaaaacttgacttccaga
ggctatgatgtcgtagtgtcactgtctgattttttgtatcttgattgtggctacgctgga
tgggtaacaaatgatcctagatatgtcgaaataccagaaaacattgacttcaacacaggc
caaggaggaagttggtgcggaccctataagtcatatcaacgaatttacaactttgatttt
actgccaatttgactgaggcagaaaaagaacatgttttaggtgccgaggctgcgttatgg
tcagagcaagttgattctactgtcttgactacaaagatatggccccgtactacagcactt
gccgaattaacatggagcgggaacaaggatcgcaaaggacaccacagaggatatgaattc
actcaaagaatattaaacttcagggagtatttaattaagttaggatacaatgtttctccg
ttggtgccaaaatactgtttgctaaacccacacgcttgtgatttgtataaaacacctcca
gtttattag

  All links  
No link information was found.   
DBGET integrated database retrieval system