KEGG   Candida dubliniensis: CD36_53520Help
Entry
CD36_53520        CDS       T01140                                 

Definition
guanylate kinase, putative (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cdu  Candida dubliniensis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cdu00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:892728..893300
Genome map
AA seq 190 aa AA seqDB search
MSSSANRPIVISGPSGTGKSTLLKKLFAEYPDRFGFSVSNTTRKPRPGEVDGKDYNFSTV
EEFKKLIDENKFIEWAQFSGNYYGTTIKAVKDVAEQGRTCLLDIDMQGVKSVKKTDLNAR
YLFISPPSIEELKSRLTGRGTETEDSLQKRIAAASDEMEYAQTGAHDKIIVNDDLDKAYA
EFKKFIVDEQ
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcatctgcaaatagaccaatagttatttccggtccttcaggtactggtaaatca
actttattgaaaaaattatttgctgaatatcctgatagatttggattttcagtttccaac
accaccagaaaaccaagacctggtgaagttgatgggaaagattataattttagtacagtt
gaagaatttaaaaaattaattgatgaaaacaaatttattgaatgggcccaattttctggt
aattattatggtacgacaattaaagctgtgaaagatgttgctgaacaaggtagaacttgt
ttattggatattgatatgcaaggggtcaaatcagttaagaagactgatttgaatgccaga
tatctttttataagtcctccatctattgaagaattgaaaagtcgattgacaggtagagga
actgaaactgaagacagtttacaaaaaagaattgctgctgcttctgatgaaatggaatat
gcccaaactggtgctcatgataaaataattgttaatgatgatttggataaagcttatgct
gaatttaagaaatttatcgttgatgaacaataa

DBGET integrated database retrieval system