KEGG   Candida dubliniensis: CD36_54000Help
Entry
CD36_54000        CDS       T01140                                 

Definition
member of the protein disulfide-isomerase family, putative (EC:5.3.4.1)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
cdu  Candida dubliniensis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CD36_54000
Enzymes [BR:cdu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CD36_54000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:1012362..1013261
Genome map
AA seq 299 aa AA seqDB search
MFFNHLLALVHILILVSAGSQADEYASDPNIFELTPSNFDKVVHKSNYTTLVKFYAPWCG
YCQKLQPVYHKLGKYINKDAKYSINIASVNCDKDYNKQLCSQYQVRGFPTLMVFRPPKYE
KGKQVKLQKHASEVYQGERSVKSITKFLTSRLKNYVKKFHNIKSDGVAEWLAEDKPSVLL
ISNANSVSPLLKSLAIDFLDRVKVGMISKFNDEPHKLVIGDKEIEVPSTSKSMLFYFNKE
KGELVAYTKSEKLNDKVKITEWIIEQTQQQPAEGPLSKKENKYYYKYRTGKKKIEHDEL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtttttcaatcacttgttggcattggttcacattcttattttagtttctgctggatca
caagcagatgaatatgcgtcagacccaaatatatttgagttgacgccttcaaattttgac
aaagtagtccacaagtctaattacactactttggtaaagttctacgccccttggtgtgga
tattgtcagaaattacagcctgtgtatcataaattgggaaaatatatcaataaggatgca
aagtattctattaacattgctagtgtgaattgtgacaaggactacaataaacagttgtgt
tcacaatatcaagttcgaggattccccacactaatggtgttcagacctcctaagtacgaa
aaggggaaacaagtaaagttgcagaaacatgccagtgaagtttaccaaggtgaaagaagt
gtcaagtcaatcaccaagtttttaacttcaaggttgaaaaattatgtcaaaaagtttcac
aacatcaagagtgacggcgtcgcagaatggttagcagaagataaaccttctgttttactt
atttccaatgcaaacctggttagtccattgttgaaatccctagccattgattttctcgat
cgagtcaaagtcggaatgatatccaaattcaacgatgagcctcataaacttgttattggc
gataaggaaattgaagttccatccacctctaaatcgatgttgttctattttaacaaggaa
aaaggagagttggtagcttatacaaaatctgaaaaattgaacgacaaggtgaaaataact
gaatggataatagaacaaactcagcaacaaccagcggagggtccattatccaaaaaagaa
aacaaatactattacaaatatagaaccgggaaaaagaaaatagaacatgacgaattatag

DBGET integrated database retrieval system