KEGG   Candida dubliniensis: CD36_54080Help
Entry
CD36_54080        CDS       T01140                                 

Definition
ubiquitin carboxyl-terminal hydrolase, putative (EC:3.4.19.12)
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
cdu  Candida dubliniensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(join(1022964..1023866,1023935..1023973))
Genome map
AA seq 313 aa AA seqDB search
MSQSGWNTIDSDAGVFTELVEKLGVENIEINDLYSIDSDTLRALQPIHGLIFLFKYSKID
REFANSNQPITGEYDGDYLDHDIFFAHQTIQNACATQAVLNILFNLQDVSLGEELNNFKS
FVTGFDSEMIGETISNSDLIRSIHNSFSTPHSFVDEDKPAPPPDRDDKDDGLFHFVGYIF
KRGKIYELDGLKQYPISHGACNGQDEFIQKLPAIVQERISKYGNELRFSLLAVTNNKLEQ
AQAMGDQEEIAHQLHKRELWKKENELRKHDYTGLIVQLLKNISKEKSDKEWDEFLQKGRD
KTQHLIAQSIKKT
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaagtggatggaatactatagattcggatgcaggagttttcactgaattggtg
gaaaaattaggtgttgaaaacatagaaatcaacgatttatattcaattgattcagatacg
cttagggccttgcagccaatacatggactcatctttctattcaagtacagtaaaatagat
agagaatttgccaactctaatcaacctataaccggggagtacgatggagattacttagac
catgacatattttttgctcatcagactatccaaaatgcatgcgccactcaagctgtgctc
aatatattgttcaatttacaagacgtctcacttggtgaagaattgaacaatttcaaatca
tttgtaacgggatttgatagtgaaatgatcggagaaaccatctccaatagtgatttaata
agatctattcataattctttcctgacaccacattcatttgttgatgaagacaaacccgca
ccacctccagacagagatgacaaggatgatggattgtttcattttgttggatacattttc
aaacgggggaaaatctatgaattggatgggttgaaacagtatccaatttcccatggtgca
tgcaacggacaagacgaatttattcaaaaactacctgcaattgtacaagaacgtatatca
aagtatggcaatgagttaaggttttcgttgttggcagttaccaataacaaattggaacaa
gcacaagctatgggcgatcaagaggaaattgcacaccaattgcataagcgtgaactttgg
aaaaaagaaaatgagttgcgtaaacacgattacacggggttgatagtacagctattgaag
aacataagcaaagagaaaagtgacaaagaatgggatgagtttttgcagaaaggcagagat
aagacccaacatctcattgcacaatcaataaagaaaacataa

DBGET integrated database retrieval system