KEGG   Candida dubliniensis: CD36_54130Help
Entry
CD36_54130        CDS       T01140                                 

Definition
arginase, putative (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
cdu  Candida dubliniensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cdu01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cdu00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(1029040..1029993)
Genome map
AA seq 317 aa AA seqDB search
MSSIQYKYHPDKKASIITAPFSGGQPKGGVELGPDYILKAGFQKQIESLGWTTELKEPLE
GTEYEKMKTNDKDEFGVKNSRIVSESCQKIHDAVKGSLAEGKLPITIGGDHSIGTATVSA
SLVHDPSTCVIWVDAHADINTPKTTDSGNLHGCPLSFIMGIDRDSYPPEFSWVPQVLKSN
KLVYIGLRDVDDGEKEILRKHNIAAFSMYHVDKYGIGKVVEMALDKVNPNRDCPVHLSYD
VDAIDPSFVPATGTRVEGGLSLREGLFIAEEIAQSGLLQSLDIVETNPMLAETEEHVLDT
VSAACAIGRCALGQTLL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctattcagtataaatatcatcctgacaaaaaagcttctataattacagcacca
ttctcaggtggtcaacccaaaggtggcgtagagttaggtccagattatattcttaaagct
ggtttccaaaaacaaattgaatccttgggatggacaacggaattaaaagaaccattagaa
ggtacagaatacgaaaaaatgaaaaccaatgacaaggatgaatttggtgttaaaaattca
agaattgtcagtgagtcttgtcaaaagattcatgatgccgtcaagggaagtttggcagaa
ggtaaattaccaataaccattggtggtgaccactcgattggaactgctactgttagtgca
agtttggtgcacgatccatctacttgtgtcatttgggttgatgctcatgctgatatcaac
acaccaaaaactactgattcaggtaacttgcacggttgtccattgagttttatcatgggt
atcgatagagacagctatccaccagaattttcttgggtacctcaagtattaaaatccaac
aagttggtttatatcgggttgagagatgttgatgacggagaaaaggaaatcttacgtaaa
cacaacattgcagctttttcaatgtatcatgtcgacaaatatggaataggtaaagtcgtt
gaaatggccttggacaaagtcaatccaaaccgtgattgtccagtacacttgtcgtatgat
gttgatgccattgacccatcatttgttcccgctacaggaactagagtggaaggtggtttg
tctttgagagaaggtttgtttattgctgaagagattgctcaaagtgggcttttacaaagt
ttggatatagtggagactaacccaatgttagccgaaactgaagaacatgtgttggataca
gtcagtgcagcatgtgccataggtagatgtgcattgggccaaactttattataa

DBGET integrated database retrieval system