KEGG   Candida dubliniensis: CD36_54340Help
Entry
CD36_54340        CDS       T01140                                 

Definition
GTP cyclohydrolase I, putative (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cdu  Candida dubliniensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CD36_54340
Enzymes [BR:cdu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CD36_54340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(1071087..1071929)
Genome map
AA seq 280 aa AA seqDB search
MSNPSHNPKHHLREEDANGTQEGLKSTVPIKRSKLVASSNLVSPNFLPRDLIETPLQTRA
ASPLILNPPIDSDGLSWPSQGARLRIEQTSEEAKAREERIASAVKVILEELGEDTSREGL
LETPERYARAMLYFTKGYEDNIRDVIKRAVFEEDHDEMVIVRDIEIYSLCEHHLVPFFGK
AHIAYIPNKRVLGLSKLARLAEMYSRRFQVQERLTKQIAMALSEILKPRGVAVVIEATHM
CMVSRGVQKTGSSTTTSCMLGCFRDQQKTREEFLTLLGRK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatccatcacataatccaaaacaccatcttcgcgaagaagatgccaatggaact
caagaaggactaaaatcaactgtacctatcaaaagatctaaattggttgcttcatcgaat
ttagtatctccaaattttttacctagagatttaatagaaactcccttgcaaacacgtgca
gcatctccattgatcttaaacccaccaattgatagcgatgggttatcatggccatctcaa
ggtgcaagacttagaatagaacaaacatcagaagaagctaaagcaagagaagaacgtatt
gcctcagctgtgaaagtaattttggaggaattaggtgaggatacttcacgtgaaggatta
ttggaaacccctgaacgatatgctcgtgccatgttatacttcacaaaaggatatgaagat
aatatcagggatgttattaaaagagcagtttttgaagaagatcatgatgaaatggttatt
gtaagagatattgagatttattcgctttgtgaacatcatttggtcccatttttcgggaaa
gctcatatcgcatatattcccaataaaagagttttagggttaagtaagttggcaagatta
gcagaaatgtattccagaagattccaggtacaagaaagactaaccaaacaaattgccatg
gccttaagtgaaatcttgaaaccaagaggtgttgccgttgttattgaagccacacatatg
tgtatggttagtagaggagttcagaaaaccggttcttcaaccaccacaagttgtatgttg
ggctgcttccgtgatcaacaaaagacaagagaggaatttttaaccttattagggcggaaa
taa

DBGET integrated database retrieval system