KEGG   Candida dubliniensis: CD36_54340Help
Entry
CD36_54340        CDS       T01140                                 

Definition
(RefSeq) GTP cyclohydrolase I, putative
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
cdu  Candida dubliniensis
Pathway
cdu00790  Folate biosynthesis
cdu01100  Metabolic pathways
Module
cdu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CD36_54340
Enzymes [BR:cdu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CD36_54340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-GeneID: 8048385
NCBI-ProteinID: XP_002420728
UniProt: B9WI16
Position
5:complement(1071087..1071929)
Genome map
AA seq 280 aa AA seqDB search
MSNPSHNPKHHLREEDANGTQEGLKSTVPIKRSKLVASSNLVSPNFLPRDLIETPLQTRA
ASPLILNPPIDSDGLSWPSQGARLRIEQTSEEAKAREERIASAVKVILEELGEDTSREGL
LETPERYARAMLYFTKGYEDNIRDVIKRAVFEEDHDEMVIVRDIEIYSLCEHHLVPFFGK
AHIAYIPNKRVLGLSKLARLAEMYSRRFQVQERLTKQIAMALSEILKPRGVAVVIEATHM
CMVSRGVQKTGSSTTTSCMLGCFRDQQKTREEFLTLLGRK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatccatcacataatccaaaacaccatcttcgcgaagaagatgccaatggaact
caagaaggactaaaatcaactgtacctatcaaaagatctaaattggttgcttcatcgaat
ttagtatctccaaattttttacctagagatttaatagaaactcccttgcaaacacgtgca
gcatctccattgatcttaaacccaccaattgatagcgatgggttatcatggccatctcaa
ggtgcaagacttagaatagaacaaacatcagaagaagctaaagcaagagaagaacgtatt
gcctcagctgtgaaagtaattttggaggaattaggtgaggatacttcacgtgaaggatta
ttggaaacccctgaacgatatgctcgtgccatgttatacttcacaaaaggatatgaagat
aatatcagggatgttattaaaagagcagtttttgaagaagatcatgatgaaatggttatt
gtaagagatattgagatttattcgctttgtgaacatcatttggtcccatttttcgggaaa
gctcatatcgcatatattcccaataaaagagttttagggttaagtaagttggcaagatta
gcagaaatgtattccagaagattccaggtacaagaaagactaaccaaacaaattgccatg
gccttaagtgaaatcttgaaaccaagaggtgttgccgttgttattgaagccacacatatg
tgtatggttagtagaggagttcagaaaaccggttcttcaaccaccacaagttgtatgttg
ggctgcttccgtgatcaacaaaagacaagagaggaatttttaaccttattagggcggaaa
taa

DBGET integrated database retrieval system