KEGG   Candida dubliniensis: CD36_54420Help
Entry
CD36_54420        CDS       T01140                                 

Definition
6-phosphofructokinase subunit alpha, putative (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cdu  Candida dubliniensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CD36_54420
   01230 Biosynthesis of amino acids
    CD36_54420
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD36_54420
   00030 Pentose phosphate pathway
    CD36_54420
   00051 Fructose and mannose metabolism
    CD36_54420
   00052 Galactose metabolism
    CD36_54420
  Energy metabolism
   00680 Methane metabolism
    CD36_54420
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CD36_54420
Enzymes [BR:cdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CD36_54420
Protein phosphatases and associated proteins [BR:cdu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CD36_54420
Messenger RNA biogenesis [BR:cdu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CD36_54420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:1088060..1091056
Genome map
AA seq 998 aa AA seqDB search
MPSPDAINRISYISLVTSDIDKFNQTFQFYSQLGFRLTKSFSKISSYGSGLGDNHPEFQL
GVSHDSLKEAWLESYPLQNIDNNGNLRPWQEMEIYDGDNCQRLNESTVIKIRLLNEKFFL
NSSIPQQKQFVFFTTQLNQIENILNNLNIKYGKIIDNVILTEDPLNNIISFSNTENELCK
TRYLSPEDFVEKTTTEILTKRKKLQLDSKYGSFEEISSTEVTNGGNGGNGGNGGGGRKKK
IGVMTSGGDAPGMNPAVRAVVRAGIYYGCDVYAVYEGYEGLVKGGDLLKKMEWSDVRSYM
SLGGTSIGTARCKEFRERTGRLQGAYNMIKNGIDALVVCGGDGSLTGADLFRSEWPSLVK
ELVDSGRLTKEEVSPYEHLTIVGLVGSIDNDMSGTDVTIGAFSALERITEMVDYIGATAA
SHSRAFVVEVMGRHCGWLALLSGLATGADFVFIPERPPKAGLWKEQLKEVCLRHREYGRR
KTTVIVAEGAIDDELNPITSEEVKQVLVDLGLDTRNTILGHVQRGGTAVAYDRRLATLQG
VEAVKAVLEMTPETPSPMIGILKHKIVRIPLVDAVKQTKAVAEAISNKDFDKAMGLRDNS
FYDDYRYFRDISIYDDGSKQLNEDKRLNIAIVHVGAASAGLNAATRAVALYSLSRGHKLY
AIQDGFTGLVKGNLKNLTWMDVEGWHNLGGSEIGTNRSLPSQNFGQVAYNLQKYNIQGLL
IVGGFEAFTSLHELSQQKSNYPIFEIPMVVVPATVSNNVPGTEYSLGSDTCLNQLVSYCD
AVQQSASSTRRRVFVVEVQGGHSGYVASYCGLITGALATYTPESNINLRELQGDIDLLQK
VFATDRGEDHNGTLIVRNEQASVVYSTELIANILKENANKRFETRTAIPGHVQQGFTPSA
NDRVMAVKFSLKAMEFIETRNGCYDKQNRKFSDEEISEHSQVVIGIHGDVVKFTCIKHLY
ENEANVILRKGKTVHWTDMIDVANILNGKSLLKKQERY
NT seq 2997 nt NT seq  +upstreamnt  +downstreamnt
atgcctagtcctgacgcaattaataggataagttatatatcccttgtcactagtgatatt
gataaattcaatcaaacattccaattttatagtcaattgggatttagattaacgaaaagt
ttttcgaaaatttcaagttatggatcaggattaggtgataatcatccagaattccaatta
ggagtttctcatgattcacttaaagaagcatggttagaatcttatccattacaaaatatt
gataataatggtaatcttcgtccttggcaagaaatggaaatttatgatggtgataattgt
caaagattaaatgaatcaactgttattaaaattagattacttaatgaaaaatttttttta
aattcatcaattcctcaacaaaaacaatttgtatttttcactactcaattgaatcaaatt
gaaaatattttaaataatttaaatattaaatatgggaaaattattgataatgttatttta
actgaagatcctttaaataatattattagtttttctaatactgaaaatgaattatgtaaa
acaagatatttatcaccagaagattttgttgaaaaaactactactgaaatattgaccaaa
agaaaaaaacttcaattggattccaaatatggttcatttgaagaaatttcatcaactgaa
gttactaatggtggtaatggtggtaatggtggtaatggtggtggtggtcggaaaaagaaa
attggggtgatgacatctggtggtgatgctccaggtatgaatccagcagttcgagctgtt
gttagagctggtatttattatggttgtgatgtttatgcagtttatgaaggatatgaagga
ttagttaaaggaggtgatcttttaaaaaaaatggaatggagtgatgttcgttcttatatg
tcacttggtggtacttcaattggtactgctagatgtaaagaatttagagaaagaacagga
agattacaaggagcatataatatgattaaaaatggtattgatgcattagttgtatgtggt
ggtgatggttcattaactggtgctgatttatttagaagtgaatggccatcacttgttaaa
gaattagtagatagtggaagattaactaaagaagaagtttctccttatgaacatcttact
attgttggattagttggttccattgataatgatatgtcgggtactgatgttactattggt
gctttttctgcattagaaagaatcacagaaatggttgattatattggtgccactgctgct
tctcattctcgtgcttttgttgttgaagttatgggtagacattgtggttggttagcttta
ttatctggtttagctactggagctgattttgttttcattcctgaacgaccacctaaagct
ggattatggaaagaacaattaaaagaagtatgtttaagacatagagaatatggtagaaga
aaaactacagttattgttgctgaaggagctattgatgatgaattaaatccaattacttca
gaagaagttaaacaagttttagttgatttaggattggatacaagaaataccattttaggt
catgttcaaagaggtggtactgctgttgcttatgatagaagattagccactttacaaggg
gttgaagcagttaaagcagttttagaaatgactccagaaactccatcaccaatgattggg
atattaaaacataaaattgttagaattcctttagttgatgcagttaaacaaactaaagct
gtagctgaagccattagtaataaagattttgataaagccatgggattaagagataatagt
ttttatgatgattatagatatttccgtgatatttccatttatgatgatggtagtaaacaa
ttgaatgaagataaaagattaaatattgccattgttcatgttggtgctgcttctgctgga
ttaaatgctgctactcgtgctgtagcattatatagtctttctcgtggtcataaattatat
gctatacaagatggatttactggattagtcaaaggtaatttgaaaaatttgacatggatg
gatgttgaaggttggcataatcttggtggttcagaaattggtactaatagatctttacca
tcacaaaattttggtcaagttgcttataatttacaaaaatataatattcaaggattatta
attgttggtggatttgaagcttttacttcattacatgaattatctcaacaaaaatccaat
tatccaatatttgaaatccctatggttgttgttccagcaacagtttctaataatgttcct
ggtacagaatattctcttggttctgatacttgtttaaatcaattagtttcatattgtgat
gcagttcaacaatcagcttcttctactagaagaagagtatttgttgttgaagttcaaggt
ggtcatagtggttatgttgcctcatattgtggattaataactggtgctttagccacttat
actccggaatcaaatataaatttaagagaattacaaggagatattgatttattacaaaaa
gtatttgccactgatcgtggtgaagatcataatggtactcttattgttagaaatgaacaa
gctagtgttgtttattcaacagaattgattgctaatattcttaaagaaaatgctaataaa
cgatttgaaactagaactgcaattcctggtcatgttcaacaaggttttactccaagtgct
aatgatcgtgttatggcagttaaattttctttaaaagctatggaatttattgaaacaaga
aatggttgttatgataaacagaatcgtaaattttctgatgaagaaattagtgaacattct
caagttgttattggtattcatggagatgttgttaaattcacatgtatcaaacatttatat
gagaatgaagctaatgttatattaagaaaaggtaaaacagttcattggacagatatgatt
gatgtggctaatattttgaatggtaaactgttgttgaaaaaacaagaaagatattag

DBGET integrated database retrieval system