KEGG   Candida dubliniensis: CD36_54760Help
Entry
CD36_54760        CDS       T01140                                 

Definition
(RefSeq) Ca++/calmodulin-regulated type 2B protein phosphatase, putative
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
cdu  Candida dubliniensis
Brite
Protein phosphatases and associated proteins [BR:cdu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     CD36_54760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_4 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 8048426
NCBI-ProteinID: XP_002420770
UniProt: B9WI58
Position
5:complement(1180593..1181114)
Genome map
AA seq 173 aa AA seqDB search
MGANASILDGFIEDTNFSIEEIDRLRKRFMKLDKDGSGQIDKQEFLSIPGISSNPLATRL
MDVFDKDGDGSIDFEEFITGLSAFSGKSDNLNKLRFAFNIYDIDRDGYIGNGELFIVMKM
MVGKNLKDEELQQIVDKTLMEADLDGDGKLNFEEFKNAVNTDTIANTLTLNMF
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgggggctaacgcaagtattcttgatggttttattgaagataccaattttagtattgaa
gagatcgatagattgcgtaaaaggttcatgaaattagataaagatggatcagggcaaatt
gataagcaagaatttttgtctatacctgggattagttcgaatccattagccaccagatta
atggatgtgtttgataaagatggagacgggtcgattgattttgaagagtttattactggg
ttatctgcattctcgggaaaatcagataatttaaacaaattaagatttgcattcaatata
tacgatattgatcgcgatggctacattggaaatggtgaattatttattgtaatgaaaatg
atggttggtaaaaacttaaaagatgaggaactacaacaaattgtggataagactttaatg
gaagctgacttggatggcgatggtaagttgaattttgaagaatttaaaaatgcggttaat
accgatacaattgccaacactttgaccttaaatatgttctag

DBGET integrated database retrieval system