KEGG   Candida dubliniensis: CD36_54760Help
Entry
CD36_54760        CDS       T01140                                 

Definition
Ca++/calmodulin-regulated type 2B protein phosphatase, putative
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
cdu  Candida dubliniensis
Brite
Protein phosphatases and associated proteins [BR:cdu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     CD36_54760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(1180593..1181114)
Genome map
AA seq 173 aa AA seqDB search
MGANASILDGFIEDTNFSIEEIDRLRKRFMKLDKDGSGQIDKQEFLSIPGISSNPLATRL
MDVFDKDGDGSIDFEEFITGLSAFSGKSDNLNKLRFAFNIYDIDRDGYIGNGELFIVMKM
MVGKNLKDEELQQIVDKTLMEADLDGDGKLNFEEFKNAVNTDTIANTLTLNMF
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgggggctaacgcaagtattcttgatggttttattgaagataccaattttagtattgaa
gagatcgatagattgcgtaaaaggttcatgaaattagataaagatggatcagggcaaatt
gataagcaagaatttttgtctatacctgggattagttcgaatccattagccaccagatta
atggatgtgtttgataaagatggagacgggtcgattgattttgaagagtttattactggg
ttatctgcattctcgggaaaatcagataatttaaacaaattaagatttgcattcaatata
tacgatattgatcgcgatggctacattggaaatggtgaattatttattgtaatgaaaatg
atggttggtaaaaacttaaaagatgaggaactacaacaaattgtggataagactttaatg
gaagctgacttggatggcgatggtaagttgaattttgaagaatttaaaaatgcggttaat
accgatacaattgccaacactttgaccttaaatatgttctag

DBGET integrated database retrieval system