KEGG   Candida dubliniensis: CD36_60860Help
Entry
CD36_60860        CDS       T01140                                 

Definition
hydrogen peroxide resistance protein, putative (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cdu  Candida dubliniensis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:cdu00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:cdu00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:179924..180409
Genome map
AA seq 161 aa AA seqDB search
MSKFYELAPKDAKGEPYPFEQLKGKVVLIVNVASKCGFTPQYKGLEELNKKFADQPVQIL
GFPCNQFGHQEPGTNEEIGSFCSLNYGVTFPVLDKIEVNGDNTDPVYKYLKSQKSGVLGL
TRIKWNFEKFLIDQNGKVIERFSSLTSPESIGARIEELLKK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaattttacgaattagctccaaaagacgccaaaggtgaaccatatccatttgaa
caattgaaagggaaagttgttcttattgtcaatgttgcttccaaatgtggattcactcct
caatacaaaggtttagaagaattgaataagaaatttgctgatcaaccagtacagatcttg
ggtttcccatgtaatcaatttggtcatcaagaaccaggtactaatgaagaaattggatca
ttctgttcattaaattatggtgttacattcccagtattggataaaatcgaagtcaatggt
gataataccgatccagtttataaatatttgaaatcacaaaagagtggtgttttgggattg
accagaattaagtggaattttgaaaaattcttgattgatcaaaatggtaaagttattgaa
agattcagttcattgacaagtccagaaagtattggtgctaggattgaagaattgttgaag
aagtaa

DBGET integrated database retrieval system