KEGG   Candida dubliniensis: CD36_61040Help
Entry
CD36_61040        CDS       T01140                                 

Gene name
HAL21
Definition
3'(2'),5 bisphosphonucleoside 3'(2')-phosphohydrolase, putative (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cdu  Candida dubliniensis
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cdu00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:complement(205028..206209)
Genome map
AA seq 393 aa AA seqDB search
MKSFFLLTLSILLISLLVTYKPLTTKLNLFTRFISMSHSTHPYQKELEVATLAVKRASLL
TKQLSDSIVQTAKSGTLTKDDKSPVTIGDFASQAIINHAIKLNFAEDEIVGEEDSQELQE
NSSLADQVLNLITKIQQETSGYNDIVGTLTDKKKVFQSIDYGNSQGGSKGRFWALDPIDG
TKGFLRGDQFAVCLALIEDGEVVLGVIGCPNLSEHIVSNEEHSGIVGGLYSAIKGVGSFY
SELFKEGAEPLSQQRPIKMQNHTHPNQLKVVEGVEKGHSSHSTQAEIKGKLGFDPTTVAN
QTINLDSQVKYCVLASGQADIYLRLPVSDTYREKIWDHAAGNILIYESGGQVGDVTGAPL
NFGKGRTLDSKGVIAANKEIFAKVIDAVTEVRK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcattcttcctcttaacactctccatattgctcatctcactacttgtcacatat
aaacccctcaccaccaaactaaatttattcactcgtttcatttcgatgtcccattctacc
cacccataccagaaggagcttgaagttgcaactttagctgtcaagcgtgcatcattgctc
accaaacaattgagtgattctattgtgcagactgccaagtcggggacactcaccaaagac
gacaagtcacctgtcaccattggagactttgccctgcaggcgatcatcaatcatgccatt
aaattgaacttcgctgaggacgaaattgttggtgaagaagattcacaggagttacaggaa
aacagcagtttagctgaccaagtattgaatttaatcaccaagatccaacaagaaactagc
ggatacaacgatattgttgggacgttgacggacaagaagaaagtatttcaaagcattgat
tatgggaattcgcaaggaggactgaagggaagattctgggcattagacccaattgacggg
actaaagggtttctccgaggtgatcaatttgctgtgtgtcttgcgttgattgaagatgga
gaagttgtgttgggtgtaattgggtgtccaaatttactggaacacattgtgtcgaacgaa
gaacactcagggattgttggtggattgtattctgccataaaaggagttggttctttctac
agtgagttgttcaaagaaggtgctgagccattgtcacaacaaagacccatcaaaatgcaa
aaccatacacaccctaaccagttgaaggtcgttgaaggtgtcgagaaaggtcattcttct
cattcaacgcaagctgaaatcaaaggcaagttaggatttgatccaaccaccgtggcaaat
caaactatcaatctcgactcgcaagtcaagtactgtgtgttggccagtggacaggcagat
atttatctcagattgccagtgagcgacacataccgtgagaaaatctgggaccatgcagct
ggtaatattttaatatatgagagtggtggccaagtaggcgatgttactggagcaccatta
aattttggtaagggaagaacattggattctaaaggtgtgattgctgctaacaaagagata
tttgcaaaggttatagatgctgttactgaagtgagaaagtaa

DBGET integrated database retrieval system