KEGG   Candida dubliniensis: CD36_61120Help
Entry
CD36_61120        CDS       T01140                                 

Definition
3'(2'),5'-bisphosphate nucleotidase, putative (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cdu  Candida dubliniensis
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CD36_61120
Enzymes [BR:cdu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     CD36_61120
Transfer RNA biogenesis [BR:cdu03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    CD36_61120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:212491..213672
Genome map
AA seq 393 aa AA seqDB search
MKSFFLLTLSILLISLLVTYKPLTTKLNLFTRFISMSHSTHPYQKELEVATLAVKRASLL
TKQLSDSIVQTAKSGTLTKDDKSPVTIGDFASQAIINHAIKLNFAEDEIVGEEDSQELQE
NSSLADQVLNLITKIQQETSGYNDIVGTLTDKKKVFQSIDYGNSQGGSKGRFWALDPIDG
TKGFLRGDQFAVCLALIEDGEVVLGVIGCPNLSEHIVSNEEHSGIVGGLYSAIKGVGSFY
SELFKEGAEPLSQQRPIKMQNHTHPNQLKVVEGVEKGHSSHSTQAEIKGKLGFDPTTVAN
QTINLDSQVKYCVLASGQADIYLRLPVSDTYREKIWDHAAGNILIYESGGQVGDVTGAPL
NFGKGRTLDSKGVIAANKEIFAKVIDAVTEVRK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcattcttcctcttaacactctccatattgctcatctcactacttgtcacatat
aaacccctcaccaccaaactaaatttattcactcgtttcatttcgatgtcccattctacc
cacccataccagaaggagcttgaagttgcaactttagctgtcaagcgtgcatcattgctc
accaaacaattgagtgattctattgtgcagactgccaagtcggggacactcaccaaagac
gacaagtcacctgtcaccattggagactttgccctgcaggcgatcatcaatcatgccatt
aaattgaacttcgctgaggacgaaattgttggtgaagaagattcacaggagttacaggaa
aacagcagtttagctgaccaagtattgaatttaatcaccaagatccaacaagaaactagc
ggatacaacgatattgttgggacgttgacggacaagaagaaagtatttcaaagcattgat
tatgggaattcgcaaggaggactgaagggaagattctgggcattagacccaattgacggg
actaaagggtttctccgaggtgatcaatttgctgtgtgtcttgcgttgattgaagatgga
gaagttgtgttgggtgtaattgggtgtccaaatttactggaacacattgtgtcgaacgaa
gaacactcagggattgttggtggattgtattctgccataaaaggagttggttctttctac
agtgagttgttcaaagaaggtgctgagccattgtcacaacaaagacccatcaaaatgcaa
aaccatacacaccctaaccagttgaaggtcgttgaaggtgtcgagaaaggtcattcttct
cattcaacgcaagctgaaatcaaaggcaagttaggatttgatccaaccaccgtggcaaat
caaactatcaatctcgactcgcaagtcaagtactgtgtgttggccagtggacaggcagat
atttatctcagattgccagtgagcgacacataccgtgagaaaatctgggaccatgcagct
ggtaatattttgatatatgagagtggtggccaagtaggcgatgttactggagcaccatta
aattttggtaagggaagaacattggattctaaaggtgtgattgctgccaacaaagagata
tttgcaaaggttatagatgctgttactgaagtgagaaaatga

DBGET integrated database retrieval system