KEGG   Candida dubliniensis: CD36_62110Help
Entry
CD36_62110        CDS       T01140                                 

Gene name
PLB1
Definition
lysophospholipase precursor, putative (EC:3.1.1.5)
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
cdu  Candida dubliniensis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CD36_62110 (PLB1)
Enzymes [BR:cdu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CD36_62110 (PLB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:420145..421962
Genome map
AA seq 605 aa AA seqDB search
MNLYHLFILLIINYCVATSPTKGYAPGPVSCPSNQLTRSGSQGINPNEQSYINARYPIAK
QALSQFLHNAKLQDFDVDSFLAHSNPTIGIAFSGGGYRSMLTGAGEISSLDSRTKSNTPV
LAGILQASSYIAGLSGGSWLVGSLASNNLISVDDMLSQGLWELTHSFLSYYGIEHPIKQV
EAWVDVATQVNSKRNANFNVSLTDIYGRLLSYPLLTNTENEGDAYLWSDVTSTSSFQSHQ
IPFPILISDGRAPDTTIINLNSTVIELTPYEFGSWDPSLNEFVDTRYLGTKLDNGLPTGQ
CYNGFDNAGFFIGTSSALFNQAVLSINNANIPSFLKNIIDDILVDPVLKSNIDVSAYNPN
PFFKSSGGNTPISQSKDLYLVDGGEDGQNIPLSPLLHRKVSAIFAFDNSNDISNWPDGSS
LVKTYERQFSPQGNGVAFPYVPDQYTFRNLNLTSRPTFFGCDAKNLTSLTKDIYDVPLVI
YLANRPFTYWSNTSTFKLTYDDNERQGMISNGFEIATRSSGSLDNEWAACVGCAIIRREQ
ERQGIEQTEQCKRCFENYCWDGTIYKGAPLGENFSDEGLTNSAAEYNSNNVAGINDGGTS
ILKKA
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgtatcatctatttattttgcttattataaactactgtgttgctacatcacca
actaaaggttacgcaccaggtccagtctcttgcccaagtaatcaattgactagatctgga
tcacaaggaatcaatcccaatgaacaatcatatattaatgctaggtatcctattgctaaa
caggcattatctcaatttttgcacaatgcaaaattacaggactttgatgtcgattcattc
ttggcacactcaaacccaactattggtattgcattcagtggtggcgggtatagatcaatg
ttgactggggcaggggaaatcagtagcttggattcaagaacaaaatccaatactccagtt
ttggcaggtattttacaagcttcaagttatattgcagggttatcgggtggatcttggttg
gttggaagtcttgcaagtaataatttaatttccgttgatgacatgttatctcaaggcttg
tgggaactcactcattcatttcttagttactatggcattgagcatcctataaagcaagtt
gaagcatgggttgatgttgctacccaagttaacagcaagagaaatgccaatttcaatgtc
tctcttactgacatatatggaagattactaagctaccccttgctaacaaacacagaaaat
gaaggtgatgcttatttgtggtccgatgtaaccagtacttcaagttttcaaagtcatcag
ataccctttccaattttgatcagtgatggtagagctccagatactaccattattaatctc
aattctactgtgattgaattaaccccatatgaatttggttcgtgggaccccagcttaaat
gaatttgttgacactagatatttgggaacaaaattagataatggccttccaactggtcaa
tgttataatggatttgacaatgctggatttttcattgggacttcttctgctcttttcaat
caagcagttttgtctataaacaacgctaacatacctagttttttgaaaaatataattgat
gatattttggtagacccagttctcaaatccaatatagacgtttctgcttacaatccaaat
ccatttttcaaaagctctggtggcaatactcctatttctcaatcaaaggacctttacttg
gttgatggaggagaagatggtcagaatattccattaagtcccttgttgcatcgtaaagta
agcgccatatttgcctttgacaattccaatgatatttcaaattggccagatgggtcttcg
ttagtgaaaacctatgaacgtcaattctcaccacagggtaatggggttgctttcccgtat
gtccctgatcaatacactttccgtaatttgaacttgactagcagacctacattttttggt
tgtgatgcaaaaaacttgacctccttgacaaaggatatttatgatgttcccttggtaatt
tacttagccaatcgtccattcacctactggtcaaatacttcaacattcaaattaacttac
gacgacaacgaaagacagggaatgatttctaatggatttgaaattgccactagatcaagt
ggatctttggataatgagtgggcagcttgtgttggatgtgccatcatacgaagagaacaa
gagagacaaggtattgaacagactgaacaatgtaagagatgttttgaaaactattgttgg
gatggcaccatctacaaaggtgctccattaggtgaaaactttagcgatgaagggttaacc
aatagtgctgctgaatataacctgaataatgtggctggtatcaatgacggaggaactctg
attttgaaaaaagcataa

DBGET integrated database retrieval system