KEGG   Candida dubliniensis: CD36_62120Help
Entry
CD36_62120        CDS       T01140                                 

Gene name
PLB2
Definition
lysophospholipase precursor, putative (EC:3.1.1.5)
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
cdu  Candida dubliniensis
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:cdu00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:423561..425390
Genome map
AA seq 609 aa AA seqDB search
MLVWQSILLFLVGCVLSKSPTNLYTPGFVQCPQGKLTRSSSDGINSNEKSYIDKRYAIAK
KELNKFLHNANMVDFDIDGFLETANPTIGLAFSGGGYRAMLAGAGALLALDSRATNASVL
GGILQSSNYIAGLSGGSWLVGSLASNDLIPVDQLLRENKLWDISNSLVAYYGLNVVENTA
MWARIDVQVQAKQLAGFTVSITDIYGRALSHQLLANFDKQGASFLWSDVTQTTSFQNNEM
PYPILAALGREPNTVLMNFNSTVFELTPYEVGSWDPSLRSFVDTKYIGTKLDDGVPTSKK
CINGFDNAGFFMGTSSSLFNVVLSNLNNMPIPSFLKELISKFTLDPVEKLNIDIAQYNPN
PFHKSNNPDTKIARSQTLYLADGGEDGQNVPLLPLVHRKVSAIFAFDQSADKDNWPDGSA
LIKTFERQFSSQGVGTAFPYVPDQNTFLNLNLTSKPTFFGCDAKNLTSLTDNIYDVPMVI
YLANRPFTYFSNTSTFKLKYSHAERQGMISNGYDVASRLNGELDNEWAACVGCAIVRREQ
ERLGIEQTEQCKRCFENYCWDGTIYKGEPLGENFSDEGLTTSAEYYNSNNVAGINDGGTV
LVKRDDVSK
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgttggtttggcaaagcatcttgttatttctagttggttgtgtcttatcaaaatcacca
actaacctttatacaccaggctttgttcagtgccctcaaggtaaattaactaggtcctct
ctggatggtatcaattccaacgaaaaatcatacattgacaaaaggtatgcaattgccaaa
aaagaattgaacaagtttctccataatgcaaacatggttgattttgatattgatgggttt
ttggaaacagcaaatccaacaattggtcttgcctttagtggcggaggctatagagccatg
ctagctggtgctggtgcattactcgctttggattcgagagcaacgaatgcttcggttttg
ggtggaatcttgcaaagttcaaattatattgctggtttatctggtggctcatggttagtt
ggaagtcttgcaagcaatgatttgataccagtagatcaacttttgcgggaaaacaaattg
tgggatatactgaattccttagttgcatactacggattaaatgttgttgagaatacagct
atgtgggctcgcattgatgttcaggttcaagccaaacaattggcaggctttactgtcagt
ataacagatatctatggaagggctttgagtcaccaattgttagccaactttgataaacaa
ggggcttcatttttatggtcagatgtaactcagaccacttcattccaaaataatgaaatg
ccatatccaatattagctgcattggggagggaaccaaacaccgtgctcatgaacttcaat
tccactgtatttgaattaaccccttatgaagtgggttcttgggatccaagtttaagaagc
tttgttgatacaaaatatatcggaaccaaacttgatgatggcgttcctacttctaaaaaa
tgtattaatggatttgacaatgcagggtttttcatggggacatcctcatccttatttaat
gttgtgttgctgaaccttaacaacatgcctatcccatcattccttaaagagcttattagc
aagtttacacttgaccctgttgaaaagttaaatattgatatcgcacaatacaatccaaat
ccattccacaaaagcaataatcccgatactaaaatagcccgatctcaaactttatacttg
gcagatggaggtgaagatggtcaaaatgttcccttgcttccattggtccatcgtaaggtg
agtgcaatctttgcctttgatcaatctgcagataaagataattggccagatggatcagct
ttaattaaaacttttgaacgacaattttcgtcacaaggagttggtactgctttcccatat
gtcccagatcagaacactttccttaacttaaatttaactagtaagccaacgtttttcggg
tgtgacgctaagaacttgacatcattaactgacaacatttatgatgttcccatggttata
tatcttgcaaatcgtccattcacatatttttctaacacatctactttcaaactcaagtat
tctcatgcagaaagacaaggaatgatttcaaacggatatgatgttgcatcacgtttgaac
ggcgaattggacaatgaatgggcagcatgtgttggatgtgctatcgtgcgcagggagcaa
gaacgtctaggaattgaacaaactgaacaatgcaagaggtgttttgagaattattgctgg
gatggcaccatctacaaaggcgaaccattaggtgaaaatttcagcgatgaaggcttgacg
actagtgcagaatactataatctgaataatgtggctggtatcaacgatggcggtactgta
ttagttaaacgagatgatgtcagtaaataa

DBGET integrated database retrieval system