KEGG   Candida dubliniensis: CD36_62280Help
Entry
CD36_62280        CDS       T01140                                 

Definition
clathrin heavy chain, putative
Orthology
K04646  
clathrin heavy chain
Organism
cdu  Candida dubliniensis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    CD36_62280
Exosome [BR:cdu04147]
 Exosomal proteins
  Proteins found in most exosomes
   CD36_62280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:451740..456755
Genome map
AA seq 1671 aa AA seqDB search
MSNDIPIDFTELTQLTQLGIPQTSLDFKSTTLESDHYICVRESGAQGNTVAIVNLKNNNE
VTRKNMTADNAIMHPKEFVISLRANGTTLQIFNLGSKQRLKAFTMDQPVIFWKWLDDTHL
GLVTQSSIYYWNVFDGTNNGPTKLTDRHHTLNNCQIINFVAEPDLNWFAVTGIAQEEGRI
AGHIQLYSKSRNVSQAIEGHVCKFASISLSGGVQPTKVFCVGNKNAQGQGNMHIIEIDHV
DGNPQFQKKVVDIFFPPDASNDFPISLQASNKYGIVYVLTKYGFIHLYDMETGANLFVNR
ITADPVFTASSYNDGTGLITINKAGQVLSVEVSRDKIIPYVLDKLSNVPLALALSSRGGF
PGAENLFQQQFQTYLNQGDYSNAAKVAASSEQLRTQDTINKLKNITPQPGQISPILQYFS
TLLDRGTLNKFESIELAKPVLQQDRKPLFEKWLKEDKLTSSEELGDIVKSYNDTTLALAV
YIRANVNIKVVSCLAELGQFDKILPYCQKVGYNPDYTNLIQNLVRVNPDKASEFATSLLS
SPDANLNVEQISDLFFSQNYIQQGTAFLLDALKNDTPAEGHLQTKVLEINLLHAPQVADA
ILGNHMFSHYDKPTIGKLCEKSGLFQRALEHYDDLKDIKRVIVHTNVLPSDWLVSYFGQL
NVDQSVACIKELLSNNMQQNLQVVIQVATKYSDLIGAAKLIKIFEEYKCTEGLYYYLSSI
VNLTQDPDVVFKYIQAAARMNQTKEIERVVRDNNVYNGEKVKNFLKEFKLDDQLPLIIVC
DRFNFVHDLILYLYKNQYFKFIEVYVQSVNPANTPQVVAGLLDVDCDENIIKGLLMSVLG
RVPIKELVEEVEKRNRLKILLPFLEKTLEGGSNDQEVYNTLAKIYIDSNNSPEKFLQENN
NYDTLVVGKYCEKRDPYLAYISYSKGGNDDQLISITNENKMYKYQARYLLSKSDIELWNK
VLSSDNIHRRQLVDQVISTGIPELDDPEPISITVKAFMENDLPEELMELLEKIILEPSPF
SENASLQGLMILTAIKADSSKVSSYIEKLDKFDPNEIAPLCIDNGLNEEAFEVYDKFELR
SEAMKVLVEDIVSLDRAEQYAEKYDTPELWYQLGTAQLDGLRIPEAIDSYVKSKNPENFA
QVIEIAEHAGKEEELITFLDMARETLREPVVDGALINAYATLDRLSDMEKFVGGSNVADL
EAIGDKLFEAKNYKAAKVLYSNVSKYAKLATTLVYLGDYQGAVDCARKASNTQVWKQVNS
ACIENKEFRLAQICGLNLIIDAEELPELVKTYEYNGYFNELIALFENGLSLERAHMGMFT
ELAILYAKYSPEKVMEHLKLFWSRINIPKVLTACEDAHLYPELIFLYCHYEEWDNAALTM
IEKSEVAFDHSSFKEIIVKAPNLEIHYKAIQFYMNENPSLLVDLLKVLTPKLDLPRVVRM
FVQSDNLPMIKPFLISVLDKNNSVVNSAYHDLLIEEEDYKSLRSSIENESNNRFNKLDLA
ERLEKHDLIFFRQIAATLYTKEKKFNRAISILKTDKLWPDLLRTVAASKSKKIAHELLDY
FVETGNHECFVALLYTSYEFIANDYVVELSWLHNLSNFIKPYEISIAYENQKKLNEVYQD
LQKRKESERQQEEEPGVGQPLMLTNGPMSYQGTGATGIGYQPTGAGFGNAF
NT seq 5016 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacgatattcctattgactttactgaattgactcagttgactcaattgggaatc
ccacaaacttctttggatttcaaatcaacaactttggaatctgatcactacatatgtgta
cgtgaatctggagctcaaggaaacaccgtggcaattgtcaatttgaaaaataacaatgaa
gtgactagaaaaaatatgacagctgataatgccattatgcaccctaaggaatttgtcatt
tcattgagagcaaatggtaccactttacaaattttcaatttgggatcaaaacaaagattg
aaggctttcactatggatcaaccagtgatattttggaaatggcttgatgatacccattta
gggttagtgacacaatcatcaatttattattggaatgtttttgatggaaccaacaatgga
ccaaccaaattgactgacagacaccacacattgaacaattgtcaaatcataaattttgtt
gctgagcctgatttaaattggtttgccgttactggtatcgcccaggaagaaggtcgtatt
gctggtcacatccaattatactcaaagtcgagaaatgtttcacaagccattgaaggtcat
gtatgtaaatttgcttctatatctttatctggcggcgttcaaccaactaaagttttctgc
gttggtaacaagaatgctcaaggtcaaggtaatatgcacattattgaaattgatcatgtt
gatggcaatccccaatttcaaaagaaagtggttgacattttcttcccacctgatgcttcc
aatgatttcccaatcagtttacaagcttctaacaaatacggtattgtttatgtattgacc
aaatacgggttcattcacttgtatgatatggaaactggggccaacttgtttgtcaacaga
ataactgctgatccagtattcactgcttctagttataacgatggcactggtttgataact
atcaacaaggcaggtcaagttttaagtgttgaagtttcccgcgacaagatcattccttat
gtattggataaattatcaaatgttccattggctttggcattatcatctcgtggtggtttc
cctggagctgaaaacttgttccaacaacaattccaaacttatttgaaccaaggcgattac
agcaatgcagctaaagttgcagcctcatccgaacaattacgtactcaggacaccatcaac
aaattgaagaatattactcctcaaccaggccaaatatcaccaattttgcaatatttctcc
actttgttggatagaggaactttgaacaaatttgaatcgattgaattggccaaaccagtc
ttacaacaagatcgtaaaccattgtttgaaaaatggttgaaagaagacaaattgacatct
tcagaagaattgggtgatatagtcaagtcttacaatgatacaactttggcacttgctgtg
tatattagagccaatgtaaatatcaaagtggtttcttgtttggctgaattgggtcaattt
gacaaaattttaccatactgtcaaaaagttggttacaatccagattacaccaatttgatt
caaaacttggttagagtcaatccagataaggccagcgaatttgccacttccttattatcc
agtcccgatgctaacttaaatgttgaacaaatttctgacttgttcttttcacaaaactac
attcaacaaggtactgcattcttgttggatgctttgaaaaacgacactccagctgaaggt
cacttgcaaaccaaagttttggaaatcaacttgttacatgcacctcaagttgctgacgcc
attttgggcaatcatatgttcagccattatgataaaccaactattggtaaattatgtgag
aaatcaggattattccaaagagctttggaacattacgacgatttgaaggatatcaagaga
gttattgtacacaccaatgttttaccaagcgattggttagtttcttattttggccaattg
aatgttgatcaatctgttgcttgtatcaaagagttattgagtaacaatatgcaacaaaac
ttgcaagtggttattcaagtggctaccaaatactcagacttgattggtgccgccaaattg
attaaaatttttgaagagtacaagtgtactgaaggattgtactattatttgagttcaatt
gttaatttgacccaggacccagatgtcgttttcaaatatatccaagctgcagctagaatg
aatcaaaccaaggaaatcgaaagagtggttagagacaacaatgtttataatggtgaaaaa
gtgaagaactttttgaaggaattcaaattggatgatcaattacctttaatcattgtttgt
gatagattcaactttgttcatgatttgattttgtatttgtacaaaaatcaatacttcaag
tttattgaagtttatgttcaatcagttaatcctgccaatactccacaagttgttgcaggt
ttattggatgttgattgtgacgaaaacatcattaaaggcttgttaatgtctgttttgggt
agagttccaatcaaggaattggttgaagaagtagaaaagagaaacagattgaaaatcttg
ttaccattcttggaaaaaacattagaaggtggatctaacgatcaagaagtatacaacact
ttagctaaaatctacattgattccaacaattcaccagaaaagtttttgcaagaaaacaac
aattacgatacattggttgttggtaaatactgtgaaaaaagagacccatatttggcttac
atttcttattctaaaggtggcaacgatgatcaattgatctctattaccaatgaaaataaa
atgtacaagtaccaagctagatatttgttatccaaatctgacattgagttatggaacaaa
gtgttaagctccgacaatatccacagaagacaattggttgatcaagtcatttccactggt
attccagaattggatgacccagaaccaatctcaatcactgttaaggcatttatggaaaat
gatttaccagaagagttgatggaattattagaaaagattattttggaaccatctccattc
agtgaaaatgcatcattacaaggattaatgattttgactgctatcaaagctgattcatcc
aaagtttcaagctatattgagaaattagacaaatttgaccctaatgaaattgctccatta
tgtattgacaatggattgaatgaagaagcatttgaagtttacgacaagtttgaattgaga
tcagaagctatgaaggttttggttgaagatattgtttcattagacagagctgagcaatat
gctgaaaaatacgacacccctgaattatggtaccaattgggtactgcacaattggatggt
ttgcgtattccagaggcaattgattcctatgttaaatctaaaaacccagagaatttcgct
caagtgattgaaattgctgaacatgctggaaaggaagaagaattgattactttcttggat
atggcaagggaaacattaagagagccagttgttgatggagcccttattaatgcctatgcc
actttggacagattgagtgatatggagaagtttgttggtggctccaatgttgctgatttg
gaagctattggtgacaagttgtttgaagccaagaattataaagctgctaaagttttgtat
tccaatgtttctaaatatgccaaattagctactactttggtgtatttgggtgattaccaa
ggtgctgttgattgtgctagaaaagcttctaacactcaagtttggaaacaagttaacagt
gcttgtattgaaaacaaagaattcagattggctcaaatttgtggtttgaatttgattatt
gatgctgaggaattacctgaattggtcaagacttatgaatacaatggttatttcaatgaa
ttaattgcgcttttcgagaatgggttgagtttggaaagagctcacatgggtatgtttact
gaattagccatcttatatgctaaatactccccagaaaaagttatggaacatttgaaatta
ttctggtctagaatcaatattccaaaagttttgactgcatgtgaagatgcacacttgtac
ccagaattgatctttttgtactgtcattacgaagaatgggataatgctgcattgacaatg
attgaaaaatcagaagttgcatttgaccattcttctttcaaagaaatcattgttaaggca
ccaaacttggaaattcattacaaggctattcaattctacatgaatgaaaacccatcattg
ttagttgatttattgaaagtgttaacaccaaaattagatttaccaagagttgttagaatg
tttgttcaaagtgacaacttgccaatgatcaaaccatttttgatttctgttttggataag
aacaactctgttgttaattctgcttaccacgatttgttaattgaagaagaagattataaa
tctttaagatcatctattgaaaatgaaagcaacaatagattcaataaattggatttggcc
gaaagattagaaaagcatgatttgattttcttcagacagattgctgctactttatacacc
aaagaaaagaaattcaatagagccatttcaattttgaaaactgataaattatggcccgat
ttattgagaacagttgctgcttccaaatctaaaaagattgctcatgaattattggattac
tttgttgaaacaggtaatcatgaatgttttgttgccttgttgtatacttcctatgaattt
attgctaatgattacgtggtggaattatcatggttgcacaacttgtccaactttatcaaa
ccatatgaaatttccattgcttatgaaaatcaaaagaaattgaatgaagtatatcaagat
ttacaaaagagaaaagaatcagaaagacaacaagaagaagaaccaggtgttggccaacca
ttgatgcttactaatggaccaatgagttatcaaggtactggtgccactggaataggttat
caaccaactggtgctgggtttggtaatgcattctaa

DBGET integrated database retrieval system