KEGG   Candida dubliniensis: CD36_63660Help
Entry
CD36_63660        CDS       T01140                                 

Definition
1,4-alpha-glucan-branching enzyme, putative (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cdu  Candida dubliniensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CD36_63660
Enzymes [BR:cdu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CD36_63660
Exosome [BR:cdu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CD36_63660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:688729..690762
Genome map
AA seq 677 aa AA seqDB search
MSKSLIQGVLDLDPWLEPFSQSLINRQIEFQNWHKKLIESEGSLIEFANSYQKYGLHTLS
NGKIQIIQYIPNVEQVSIVGDFNNWNKDNHKLNKLNEFGTWELTLESNTIPINSKYKIAM
QTKTGEWIYRLDPWVHRATFNKQQALYEGHFWEDNYKFKNPRPSSSSSTTTKEGGIKIYE
AHIGISTPEPTIGSYKNFTENILPIIHDLGYNTIQLMAIMEHAYYASFGYQVTSFFAISS
RYGTPDELKELIDTAHGMGIQVLLDIVHSHSSKNVDDGLNMFNGTDHYLFHGGNKGNHDL
WDSRLFNYTNYETLRFLLSNLKYYIDVFQFDGFRFDGVTSMLYKHHGLSVGFSGGYHEYF
GDGVDNEALIYLMLAHQLMKEISTKEGFSLTSIAEDVSGMPTLCRPISDGGIGFDYRLSM
AIPDMWIKILKHLTDEQWDIGNIVHTLTNRRYGEKVIAYCESHDQALVGDKTLAFWLMDK
EMYTNMSVLSPLTPIIDRGLALHKLIRLVTYALGGDGYLNFEGNEFGHPEWLDFPRQGNG
ESYHYARRQFNLINDDLLRYKYLYQFDKKMLQLKITNKKEYISLKHEIDKILIFEKDQSI
YIFNFNPTQSFVDYKIGVELPGTYKIILDSDAKELGGHGRLDHNTKYFTFNEPWNNRSNS
LLVYIPTRTAIVLERIE
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaatcattaattcaaggtgtattagatttagatccttggttagaaccattttct
caatcattaattaatcgacaaattgaatttcaaaattggcataaaaaattaattgaatca
gaaggttcattaattgaatttgctaatagttatcaaaaatatggattacatactttatct
aatgggaaaattcaaattattcaatatattcctaatgttgaacaagtttcaattgttgga
gattttaataattggaataaagataatcataaattaaacaaattaaatgaatttggtact
tgggaattaactcttgaatcaaatactattcctattaatagtaaatataaaattgctatg
caaactaaaacaggtgaatggatttatcgtttagatccttgggttcatagagctacattt
aataaacaacaagcattatatgaaggtcatttttgggaagataattataaatttaaaaat
cctcgtccttcttcttcttcttccaccaccaccaaagaaggtggtattaaaatttatgaa
gctcatattggaatttctacaccagaaccaacaattggtagttataaaaatttcacggaa
aatattttaccaataattcatgatcttggttataatactattcaattaatggcaattatg
gaacatgcttattatgcatcatttggttatcaagtaacaagttttttcgccatttcttct
cgttatggtactcctgatgaattaaaagaattaattgatactgctcatggaatgggtatt
caagtattattagatattgttcattctcatagttctaaaaatgttgatgatggattaaat
atgtttaatggtactgatcattatttatttcatggtggtaataaaggtaatcatgattta
tgggattctcgtttatttaattatacaaattatgaaactttaagatttttattatcaaat
ttaaaatattatattgatgttttccaatttgatggatttagatttgatggagttactagt
atgctttataaacatcatggtttatcagttggatttagtggaggttatcatgaatatttt
ggtgatggagtagataatgaagcattaatttatcttatgttagctcatcaattaatgaaa
gaaatttctacaaaagaagggttttcattaacttcaattgccgaagatgtttctggtatg
cctactttatgtcgtccaatatctgatggaggaattggttttgattatagattatcaatg
gctatccctgatatgtggattaaaattttaaaacatttaactgatgaacaatgggatatt
ggtaatattgttcatactttaactaatagaagatatggagaaaaagtcattgcttattgt
gaatctcatgatcaagctttagttggtgataaaactttagcattttggttaatggataaa
gaaatgtatactaatatgtcagtattatctcctttaacaccaattattgatagaggtctt
gctcttcataaattaattagattagtcacttatgctcttggtggtgatggatatcttaat
tttgaaggtaatgaatttggtcatcctgaatggttagatttccctcgtcaaggtaatgga
gaatcttatcattatgctcgtcgtcaattcaatttaattaatgatgatcttcttcgttat
aaatatttatatcaatttgataaaaaaatgttacaattaaaaatcactaataaaaaagaa
tatatttctttaaaacatgaaattgataaaattttaatatttgaaaaagatcaatcaatt
tatatttttaattttaatcctactcaatcatttgttgattataaaattggtgttgaatta
cctgggacttataaaattattttagattctgatgcaaaagaattaggtggtcatggtaga
cttgatcataatactaaatatttcacatttaatgaaccttggaataatagaagtaattcc
cttttagtttatattccaactagaactgccattgttttagaaagaattgaataa

DBGET integrated database retrieval system