KEGG   Candida dubliniensis: CD36_64760Help
Entry
CD36_64760        CDS       T01140                                 

Definition
poly(A) RNA export protein, putative
Orthology
K14298  
mRNA export factor
Organism
cdu  Candida dubliniensis
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:cdu03013]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:complement(932609..933775)
Genome map
AA seq 388 aa AA seqDB search
MSFLGNSSTGTSTTGTSSAVTGQELLNDITINNPPEDSIEDLSFSPQQDLLAVASWDKKV
RIYEIDPNSGNNMGRAMYEHEAPVFSSRWSIDGLKIISGGADNQVKIFDLTTQQSQQIGQ
HDSAVKSVRYVECGPNNTQIVASGSWDKTLKYWDMRSPQPVSTINLPERVYSMDNSQKLL
VVGCADRHISIIDLNNPQQIFKSSQSPLKWQTRCVSCYPQANGFAIGSIEGRCAIQYITE
NEQKKFGFSFKCHRKSGGNTTTGTTNTTTGSGTGVSGGLRTTSSSNANESHAYSVNAISF
HPIYGTFSTAGSDGTFCFWDKDAKQRLKSFPELPGTISATAFNKTGTIFAYAVSYDWSLG
YMGNRPDYPNIIKLHATKDLEIKQKNKR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcttgggtaattcatcaactggaacatcgactacaggaacatcaagtgctgtt
actggtcaagaattattaaatgatataaccataaataatcctccagaagattcaattgaa
gatctttcattttcacctcaacaagatttattggcagttgccagttgggataaaaaagtt
cgaatttatgaaattgatcctaattcaggaaataatatgggacgagccatgtatgaacat
gaagcaccagttttcagttctcgatggtcaattgatggattaaaaattatatcaggagga
gcagataatcaagtgaaaatatttgatttaactactcaacaatctcaacaaattggtcaa
catgattctgcggttaaatcagttagatatgttgaatgtggtcctaataatactcaaatt
gttgctagtggatcatgggataaaacattgaaatattgggatatgagatcacctcaacca
gtttcaacaattaatttacccgaaagagtttattcaatggataattctcaaaaattatta
gttgttggatgtgctgatagacatattagtataattgatttaaataatcctcaacaaatt
tttaaaagttctcaatctccattgaaatggcaaactcgttgtgtttcttgttatcctcaa
gcaaatggatttgctattggatctattgaaggtagatgtgctatacaatatattactgaa
aatgaacaaaaaaaatttggcttttcatttaaatgtcatagaaaatccggtggaaatact
acaactggtaccactaatactactactggcagtggtactggtgtaagtggaggattaaga
actactagtagttctaatgccaatgaatctcatgcatattcagttaatgccatatcattt
catcctatatatggtacatttagtactgctggatcagatggaacattttgtttttgggat
aaagatgctaaacaacgattaaaatcatttcctgaattacctggaacaatatctgccacg
gcatttaataaaactggtactatatttgcttatgccgttagttatgattggtcattagga
tatatgggtaatagacccgattatccaaatattattaaactacatgcaactaaagattta
gaaatcaaacaaaagaataagaggtga

DBGET integrated database retrieval system