KEGG   Candida dubliniensis: CD36_71280Help
Entry
CD36_71280        CDS       T01140                                 

Definition
subunit of the core complex of translation initiation factor 3 (eIF3), putative
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
cdu  Candida dubliniensis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CD36_71280
Messenger RNA biogenesis [BR:cdu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     CD36_71280
Translation factors [BR:cdu03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    CD36_71280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(307718..309994)
Genome map
AA seq 758 aa AA seqDB search
MSINEEDYLQLEKEIKLDDIDFSDLESKYEVNNIGLDNYIIVDGAPIAPESKVPILIKVL
RKLFSQVGEIYEGDEGIYMPLENGKSKGYLFIQFKSNESIELAIKKLHGKKLDQNHRLLI
NKLSDMEKYQVNEKFINEEFIEPKIESFQSHGYLKSWLQDEQGRDQMILHFNETVGIYWN
KKSNEPESVIEPRKGFTSKYAKFSPKGTYLFSIHPQGIQSWGGENFHSIKRFFHQQVRLI
DFSPNEKFMVTLSPIPISLPDSTIDRAQFPFGPESEGHKLVIWNMITGEPMRTFALPPHL
EGQKEMPWPLVKWSFDDKYCARQGPDALAIYETESNFQLLDKKLVKIDGIQDFEWAPAGV
KFHNTNTNNNNNKKTNDDGDGDGEHVLSYWTPESTNQTARVALMQIPSREILRTVNLFQV
SDCKMHWQSNGKLLCVKVDRHTKSGKTIFSNLEFFKINEKDIPVEKLELKDVVVNFAWEP
NTERFITISRLDDGNPNPAIPKNTISFYAPETTKTKTGNKNTNLKKKGVGAAFTNQQQQQ
QQQQQSSSKYKAYTKIENKHSNTIFWSPKGRYVVIATISRTSGELEFFDVSFDDEINKKS
LPANVKLLKTDKFAGMTNISWDPSGRFVAAWSTSWLHAIDNGYRLYEFTGNLLRDDSIDQ
FKDFVWRPRPPTLLTNNDKKKVRSNLREYSAQFEEADAMEADAAVKEIILARRKALEDWR
NYRAKHISKQGNSKNEVQAEIIEEIKEEIIEEKEEIVE
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattaatgaagaagattatcttcaacttgaaaaagaaatcaaattagatgatatt
gatttttctgatttagaatcaaaatatgaagttaataatattggattagataattatatt
atagttgatggagctccaattgcccctgaatctaaagtaccaattttaattaaagtatta
cggaaattattttcacaagttggagaaatttatgaaggagatgaaggaatttatatgcca
ttagaaaatgggaaatctaaaggatatttatttattcaatttaaatctaatgaactgatt
gaattagccattaaaaaattacatgggaaaaaattggatcaaaatcatcgattattaatt
aataaattatctgatatggaaaaatatcaagttaatgaaaaatttattaatgaagaattt
attgaaccaaaaattgaatcatttcaaagtcatggatatttaaaatcttggttacaagat
gaacaaggtagagatcaaatgattttacattttaatgaaaccgttgggatttattggaat
aaaaaatcaaatgaacctgaatcagttattgaaccaagaaaaggttttacatcaaaatat
gcaaaattttctccaaaaggaacatatttattttcaattcatcctcaaggaattcaatca
tggggtggagaaaattttcatagtattaaaagatttttccatcaacaagttagattaatt
gatttttctccaaatgaaaaatttatggtaactttatcaccaattccaattagtttaccc
gattcaactattgatagagctcaatttccatttggtccagaaagtgaaggtcataaattg
gttatttggaatatgattactggtgaaccaatgagaacatttgctttaccacctcattta
gaaggtcaaaaagaaatgccatggccattagttaaatggtcttttgatgataaatattgt
gctcgtcaaggtcctgatgctttagccatttatgaaactgaatctaattttcaattatta
gataaaaaattagttaaaattgatggtattcaagattttgaatgggctcctgctggagtt
aaatttcataatactaatactaataataataataataaaaaaaccaatgatgatggtgat
ggtgatggtgaacatgtattaagttattggactccagaaagtactaatcaaacagcaaga
gtagctttaatgcaaattccttcaagagaaattttacgtacagttaatttatttcaagtt
agtgattgtaaaatgcattggcaatctaatgggaaattattatgtgttaaagttgatcgt
catactaaatcaggtaaaacaattttttccaatttagaatttttcaaaattaatgaaaaa
gatatccctgtggaaaaattagaattaaaagatgtagtagttaattttgcttgggaacca
aatactgaaagatttattactattagtagattagatgatggtaatccaaatcctgccatt
cctaaaaataccatttcattttatgcaccagaaacaactaaaactaaaactggaaataaa
aatactaatttgaaaaagaaaggtgttggtgctgcttttacaaaccaacaacaacaacaa
caacaacaacaacaactgtcttcaaaatataaggcttataccaaaattgaaaataaacat
tcaaatacaattttttggtcaccaaagggaagatatgttgttattgccactatttcaaga
acttctggagaattggaattttttgatgtttcatttgatgatgaaattaataaaaaatca
ttacctgctaatgttaaattattgaaaactgataaatttgctggaatgactaatatttct
tgggatccatcagggagatttgttgcagcatggtcaacttcttggttacatgctattgat
aatggttatagactttatgaattcacgggtaatttattaagagatgattcaattgatcaa
tttaaagattttgtttggagaccaagaccaccaactttattaactaataatgataaaaag
aaagttagatccaatttacgtgaatatagtgcccaatttgaagaagctgatgctatggaa
gctgatgctgctgttaaagaaatcattttggctcgtagaaaagctttagaagattggaga
aattatcgtgctaaacatattagtaaacaaggtaattccaaaaatgaagttcaagcagaa
attattgaagaaattaaagaagaaattattgaagaaaaagaagaaattgttgaataa

DBGET integrated database retrieval system