KEGG   Candida dubliniensis: CD36_71470Help
Entry
CD36_71470        CDS       T01140                                 

Definition
(RefSeq) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex, putative
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cdu  Candida dubliniensis
Pathway
cdu00010  Glycolysis / Gluconeogenesis
cdu00020  Citrate cycle (TCA cycle)
cdu00620  Pyruvate metabolism
cdu01100  Metabolic pathways
cdu01110  Biosynthesis of secondary metabolites
cdu01130  Biosynthesis of antibiotics
cdu01200  Carbon metabolism
Module
cdu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD36_71470
   00020 Citrate cycle (TCA cycle)
    CD36_71470
   00620 Pyruvate metabolism
    CD36_71470
Enzymes [BR:cdu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CD36_71470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 8049333
NCBI-ProteinID: XP_002421366
UniProt: B9WK49
Position
7:356226..357656
Genome map
AA seq 476 aa AA seqDB search
MSALFAVSRSAMALRTIAPRSYTATSSSFLALARLYSSGKFPPHTVINMPALSPTMTQGN
IQSWAKKVGDELTPGEAIAEIETDKASMDFEFQEEGYLAKILLDAGAKDVPVGQPIAVYV
EDASEVAAFEDFTAADAGEAPKPAPAAAEEAPKKEEPKASTTTQAPASTGAPSSKKAPTD
RIIASPFAKTIALEKGISLKGIKGSGPNGRIVAKDLEGVEPQAAAAAPATPAATTGAAPS
ATASYEDIPITSMRKTIASRLLQSTQQSPSYIIQSQISVSKLLKLRASLNATAEERYKLS
INDLLIKAIARTCVRVPEVNAAWLGEQGVIRQYKNVDVSVAVATPTGLITPIVTNAESKG
LAEISNQVKDLGKRAKVGKLLPEEFQGGTICISNLGMNHAVTAFTSIINPPQSAILAIGT
TEKKAVPSEVNEQGFVFDDVITITGTFDHRVIDGALGGEWMKELKRIVENPLEMLI
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctttatttgctgtttccagatcagcaatggctcttcgtaccattgctccaaga
agttatactgccacctcttcatcattcttagcattagcaagattatattcatctggcaaa
ttcccaccacatactgttatcaacatgccagcattatccccaaccatgactcaaggtaac
attcaatcttgggccaaaaaagttggtgatgaattaacaccaggtgaagcaattgccgaa
attgaaaccgataaagcatcaatggattttgaattccaagaagaaggttatttggccaag
attttattggatgctggtgctaaagacgttccagttggtcaaccaattgccgtttacgtt
gaagatgctagtgaggtagcagcatttgaagatttcactgctgctgatgccggagaggca
ccaaaaccagcacctgctgctgctgaagaagccccaaagaaagaagaaccaaaagcttct
accaccactcaagctccagcttccactggagcaccttcttccaaaaaggcaccaaccgac
agaataattgcatcgccatttgctaaaaccattgctttagagaaaggtatttccttgaaa
ggcattaaagggtcaggtccaaatggtagaattgttgccaaggatcttgaaggtgttgaa
ccacaagctgctgctgccgctccagctactccagctgctaccacaggtgccgcaccaagt
gccactgcttcttacgaagatattccaattacttccatgagaaagacaattgcttccaga
ttattacaatctacccaacaatccccatcatacattattcagtcacagatttccgtgtct
aaattattgaaattacgtgcttcattgaatgctactgccgaagaaagatacaagttatct
atcaatgatttattaatcaaggctattgccagaacctgtgttagagttccagaagttaat
gctgcttggttaggcgaacaaggtgttatcagacaatacaagaacgttgatgtttctgtt
gctgttgccaccccaaccggattaatcactccaattgtcactaatgctgaatctaaaggt
ttggctgaaatctccaaccaagttaaagatttgggtaagagagccaaagttggtaaattg
cttccagaagaattccaaggtggtaccatctgtatttccaacttgggcatgaaccatgct
gtcactgccttcacatctattattaacccaccacaatctgccattcttgctattggcact
actgagaagaaggctgttccaagtgaagttaatgaacaaggatttgtgtttgatgatgtt
atcactattactggtacttttgatcacagagttattgatggtgcccttggtggtgaatgg
atgaaagaattgaagagaattgttgaaaatccattagaaatgttgatctaa

DBGET integrated database retrieval system