KEGG   Candida dubliniensis: CD36_71470Help
Entry
CD36_71470        CDS       T01140                                 

Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex, putative (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cdu  Candida dubliniensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:cdu01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cdu00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cdu00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cdu00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:356226..357656
Genome map
AA seq 476 aa AA seqDB search
MSALFAVSRSAMALRTIAPRSYTATSSSFLALARLYSSGKFPPHTVINMPALSPTMTQGN
IQSWAKKVGDELTPGEAIAEIETDKASMDFEFQEEGYLAKILLDAGAKDVPVGQPIAVYV
EDASEVAAFEDFTAADAGEAPKPAPAAAEEAPKKEEPKASTTTQAPASTGAPSSKKAPTD
RIIASPFAKTIALEKGISLKGIKGSGPNGRIVAKDLEGVEPQAAAAAPATPAATTGAAPS
ATASYEDIPITSMRKTIASRLLQSTQQSPSYIIQSQISVSKLLKLRASLNATAEERYKLS
INDLLIKAIARTCVRVPEVNAAWLGEQGVIRQYKNVDVSVAVATPTGLITPIVTNAESKG
LAEISNQVKDLGKRAKVGKLLPEEFQGGTICISNLGMNHAVTAFTSIINPPQSAILAIGT
TEKKAVPSEVNEQGFVFDDVITITGTFDHRVIDGALGGEWMKELKRIVENPLEMLI
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctttatttgctgtttccagatcagcaatggctcttcgtaccattgctccaaga
agttatactgccacctcttcatcattcttagcattagcaagattatattcatctggcaaa
ttcccaccacatactgttatcaacatgccagcattatccccaaccatgactcaaggtaac
attcaatcttgggccaaaaaagttggtgatgaattaacaccaggtgaagcaattgccgaa
attgaaaccgataaagcatcaatggattttgaattccaagaagaaggttatttggccaag
attttattggatgctggtgctaaagacgttccagttggtcaaccaattgccgtttacgtt
gaagatgctagtgaggtagcagcatttgaagatttcactgctgctgatgccggagaggca
ccaaaaccagcacctgctgctgctgaagaagccccaaagaaagaagaaccaaaagcttct
accaccactcaagctccagcttccactggagcaccttcttccaaaaaggcaccaaccgac
agaataattgcatcgccatttgctaaaaccattgctttagagaaaggtatttccttgaaa
ggcattaaagggtcaggtccaaatggtagaattgttgccaaggatcttgaaggtgttgaa
ccacaagctgctgctgccgctccagctactccagctgctaccacaggtgccgcaccaagt
gccactgcttcttacgaagatattccaattacttccatgagaaagacaattgcttccaga
ttattacaatctacccaacaatccccatcatacattattcagtcacagatttccgtgtct
aaattattgaaattacgtgcttcattgaatgctactgccgaagaaagatacaagttatct
atcaatgatttattaatcaaggctattgccagaacctgtgttagagttccagaagttaat
gctgcttggttaggcgaacaaggtgttatcagacaatacaagaacgttgatgtttctgtt
gctgttgccaccccaaccggattaatcactccaattgtcactaatgctgaatctaaaggt
ttggctgaaatctccaaccaagttaaagatttgggtaagagagccaaagttggtaaattg
cttccagaagaattccaaggtggtaccatctgtatttccaacttgggcatgaaccatgct
gtcactgccttcacatctattattaacccaccacaatctgccattcttgctattggcact
actgagaagaaggctgttccaagtgaagttaatgaacaaggatttgtgtttgatgatgtt
atcactattactggtacttttgatcacagagttattgatggtgcccttggtggtgaatgg
atgaaagaattgaagagaattgttgaaaatccattagaaatgttgatctaa

DBGET integrated database retrieval system