KEGG   Candida dubliniensis: CD36_71630Help
Entry
CD36_71630        CDS       T01140                                 

Definition
6-phosphofructokinase beta subunit, putative (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cdu  Candida dubliniensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CD36_71630
   01230 Biosynthesis of amino acids
    CD36_71630
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD36_71630
   00030 Pentose phosphate pathway
    CD36_71630
   00051 Fructose and mannose metabolism
    CD36_71630
   00052 Galactose metabolism
    CD36_71630
  Energy metabolism
   00680 Methane metabolism
    CD36_71630
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CD36_71630
Enzymes [BR:cdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CD36_71630
Protein phosphatases and associated proteins [BR:cdu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CD36_71630
Messenger RNA biogenesis [BR:cdu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CD36_71630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(388628..391468)
Genome map
AA seq 946 aa AA seqDB search
MISIVNGTSTLSLVAGSKQTLDQAINFYTNILGLSVHSEQNDWTYLSNDDNKMIVKIKLD
SKSGLSLDQVSDRRTEIISKLNVIDWRSLDTTSVLKVENLVALIETLTTFNYTLQITPNE
LYPNEVYCVDPLGYIIGFTACDEPLTLVPPLQKSHPKPGLVSNLMSKSGSQSRNIEETKA
VRRNIAVMTSGGDSQGMNAAVRAVVRATIFHGSKAFAVQEGYAGLVKGGPEYIKEMNWQD
VRGFLAEGGTNIGTARCMEFKERWGRLKGCKNLIDAGIDGLIVCGGDGSLTGADLFRHEW
PSLIQELKDKGEITNEQFERHKHLYICGMVGSIDNDMAMTDATIGGYSALERICRAIDYI
DATANSHSRAFVVEVMGRHCGWLALMAGIATSADYIFIPEKPASSKDWEDQMCDIVGKHR
AQGKRKTIVIVAEGAITSDLKPITSDQVKDVLVDRLGLDTRITVLGHVQRGGTAVAFDRT
LATLQGVEAVKAILELTPDVPSPLIAIDENKICRRPLVEAVRITKSVASAIEAKDFEKAM
SLRDHEFKEHLANFMAMNTANHEKPTLPLEKRKKIAIINIGAPAGGMNSAVYAMATYCMS
RGHTPYAIHNGFAGLARHESVKSIEWIDIEGWNSIGGSEIGTNRQTPEETDIGMIAHYFE
KYQFDGLIIVGGFEAFVSLEQLEKSRAMYPSFRIPMVLIPATISNNVPGTEYSLGSDTCL
NSLMEYCDIVKQSASATRGTAFIIDVQGGNSGYIATFASLISGAQASYVPEEGISLQQLE
MDINSLREAFAVEQGMTKSGKLIIKSSNASKVLTPNTLADIFNDECHGDFDTKTAIPGHV
QQGGLPSPIDRSRGDRFAIRAVQFIEDHCDVLTPYRYELDFPVDDKKILNTAAVLGIKSS
RLKFTSIRHLFDFETELGRRMPKTIYWNSIRDIADQLVGRTRLDKP
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaattgttaatggtacttccacactttcattggttgctggtagtaagcaaaca
ttagatcaagcaatcaatttttataccaacatacttgggttgtccgtccattcagagcaa
aatgactggacgtatttatcaaacgacgacaataaaatgattgtcaagataaaattagac
tccaaatctggattatctctcgatcaagtcagtgatagaagaacagagattatttccaaa
ttaaatgttattgattggagatcgttagataccaccagtgtcttgaaagttgaaaattta
gttgctttaattgaaactttaaccacatttaattacactttacaaatcacccctaatgaa
ttgtaccctaatgaagtctattgtgtggacccattgggctacattattgggtttactgct
tgtgatgaaccattaacccttgttccaccattacagaaatcccacccaaaaccagggttg
gtttccaacttgatgtcaaaatcaggttcccaatcaagaaacattgaagaaactaaagcc
gtgagaagaaatatcgctgtcatgacttctggtggggattctcaaggtatgaatgctgcc
gttagagccgttgttagagccacgattttccatggaagtaaggcctttgctgtccaagaa
ggttacgctggtttagtcaaaggtggccccgaatacattaaggaaatgaactggcaagac
gtcagaggtttccttgctgaagggggtaccaatattggtactgccagatgtatggaattt
aaggaacgttggggtagattgaaagggtgtaagaatttgattgatgctggaatcgatggg
ttgattgtgtgtggtggtgacgggtctttaaccggtgccgatttattcagacacgaatgg
ccttcattgattcaagaattaaaagataaaggtgaaatcaccaatgaacaatttgagaga
cacaaacacttgtacatttgtggtatggtgggttccattgataatgatatggccatgact
gacgcaacaattggtggttactcagcattagaaagaatttgtcgtgctattgattacatt
gatgccacagccaactcccattcgcgtgcctttgttgttgaagtcatgggtagacattgt
ggttggttagccttgatggccggtattgctaccagtgctgattatattttcattccagaa
aaacctgcttcctcaaaggattgggaagatcaaatgtgcgacattgttggtaaacataga
gctcaaggtaaaagaaagaccattgttattgttgctgaaggggctattacttctgatttg
aaaccaatcacatctgatcaagttaaagatgttttagtcgaccgattaggtttggacacc
agaatcaccgtgttgggacatgttcaaagaggtggtactgctgtggcttttgataggacc
ttagctactttgcaaggggttgaagcagttaaagccattttggaattaactcccgatgtt
ccatctccattgatcgccattgatgaaaataagatttgtcgtcgtccattggttgaagct
gtcagaatcaccaaatccgtggcttcagctatcgaagctaaggatttcgaaaaagcaatg
tctttaagagatcacgaattcaaagaacatttggctaatttcatggccatgaatactgcc
aatcacgaaaaaccaactttgcctcttgaaaaacgtaagaagattgccattattaacata
ggtgctcccgctggtggtatgaattctgctgtttatgctatggctacttattgtatgtct
cgtggtcacactccatatgctattcacaatgggtttgctggtttagcaagacacgaatca
gttaaactgattgaatggattgacattgaaggatggaatagtattgggggatcagaaatt
ggtaccaacagacaaacccctgaagaaactgacattggtatgattgcccattattttgaa
aaataccagtttgacgggttaattattgttggaggttttgaagcatttgtttctttagag
caattggaaaaatcaagagctatgtatccatctttcagaattcctatggttttaatccct
gccaccatttcgaataatgttcctggtaccgaatattctttagggtccgatacttgtttg
aattcattaatggaatattgtgacattgttaaacaatcagcatcagccaccagaggtacc
gcattcattattgatgttcaaggaggtaattctggatacattgccacgtttgcatcatta
atcagtggggcacaagcatcctacgttccagaagaaggtatttcattacagcagttggaa
atggacatcaattcgttgagagaagcatttgctgtggaacaaggaatgacaaagagtggt
aaattgatcatcaagtcgagtaatgcatctaaagtactaaccccaaacacattggcagac
atattcaatgatgaatgtcatggagactttgacaccaaaaccgctattccaggacatgtt
caacaaggtggattgccttcaccaatagatagaagcagaggtgatagatttgccattaga
gctgttcaattcattgaggatcactgtgacgttttgactccatacagatacgaattggat
ttccctgttgatgacaagaagatcttaaacacagctgctgtattaggtattaagtcttcc
cgtttgaaattcacttctatcagacatttgtttgatttcgaaactgaattaggcagaaga
atgccaaagaccatttactggaactctattagagatattgctgatcaattagtcggtcga
acaagacttgataagccataa

DBGET integrated database retrieval system