KEGG   Candida dubliniensis: CD36_72530Help
Entry
CD36_72530        CDS       T01140                                 

Definition
dolichyl-phosphate-D-mannose:protein O-D-mannosyltransferase, putative (EC:2.4.1.109)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
cdu  Candida dubliniensis
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    CD36_72530
Enzymes [BR:cdu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     CD36_72530
Glycosyltransferases [BR:cdu01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   CD36_72530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:659787..662414
Genome map
AA seq 875 aa AA seqDB search
MAKKPVSPASKVAAKQAAVRNRQQEDVFTLDPLIDPIFQKGELRSYLVTEPSPSVLKKRQ
IHTKEYWMLSSLLIIAFYVRMYNLSNPNSVVFDEVHFGGFARKYILGTFFMDVHPPLAKM
LFGAIGAIGGFKGDFEFKSIGDKFPDSTPYIFMRQFPALLGVGTVILCYLTLRQSGVRPI
IAYITTFLLIIENSNVTISRYILLDSPLIFFIAAAIYAWKKFEIQIPFTFGWYRSLLATG
IALGLALSSKWVGLFTVAWVGLLCVYQLWFLIGDLSVSTKKIWGHFFARGIILLGVPIAL
YLGFFAIHFHLLSKEGDGGAFMSSAFRAGLQGNKIPRDITEQVGLGSIVTIRHVDTQGGY
LHSHEHFYQTGSKQQQITLYPHLDSNNKWLIEPYNGTIHNETFVPLINGMKIRLKHINTG
RRLHSHDEKPPVSERDWQKECSCYGYDGFAGDANDDWVVEIVNYRSQKGEAQTFVKAINT
IFRLRHAMTGHYLFSSEVKLPEWGFGQQEVTSASQGKRSLTHWYIETNENNILPPSEAKI
INYPKLSLWQKVVESHKRMWKINQGLTSHHHWQSSPSEWPLLLRGINYWNKEHKQVYLLG
NAVTWWAATLSIITFGTYVLIAVFRWHLGTPLSSNKHVFNFNVQTFSYVLGWALHYLPFF
IMGRQLFLHHYLPALYFGILALGHFFEIFTGYLTSRSKYFQQVAFVLVGLFSILSLVFYV
NYSSLIYGTPWTKGSCELTKPFSGWDYNCGTFFETLGEYDIQDKSLASESEIPTETVVVE
AKQTPKAEPRLAKQDDHIESPPAAAAEPVEVKEVKEEIEQLAPPLAVDFEEETPKVEDPQ
VVDVDASSNDEKSVEEKQQEQPQEDEDESVQQRQQ
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaaccggtctcacccgcttctaaagttgcagcaaaacaggctgctgtcaga
aacagacaacaagaagatgtatttacacttgatccattgatagacccaatatttcaaaag
ggagaattgcgttcgtatttggtgactgaaccttcccctagtgttcttaaaaaaagacag
attcacaccaaggaatactggatgctttctagtttattgataattgctttttacgttaga
atgtataacttgtccaatccaaattccgttgttttcgatgaagtccatttcggtggtttt
gctagaaaatatattttgggtacttttttcatggatgtacatcctccattggctaaaatg
ctttttggagctattggtgccattggtggattcaaaggtgattttgaattcaaatcaatt
ggtgacaagttccctgattccacaccttatatatttatgagacaattcccggcattattg
ggtgtgggaacggttattttgtgctacttgactttgagacaatcaggtgttagaccaatt
attgcttatataactacctttttattgatcattgaaaactcaaatgttactatttcaaga
tatattttgttagattctcctttgatcttctttattgctgctgctatttatgcttggaag
aaatttgaaattcaaattccatttacctttggctggtatagaagtttgttggcaacaggg
attgctcttggtttagctttgagttccaaatgggtcggtttgttcactgtggcctgggtt
ggtctcttgtgtgtctaccaattgtggttcctcattggtgatttatcagttagtaccaag
aaaatctggggtcatttctttgcaagaggaatcatcttgttgggtgtgccaattgcctta
tatcttggattttttgctattcatttccatttgttaagcaaagaaggtgatggtggtgcc
tttatgagcagtgcctttagagccggattgcaaggtaataaaattccaagagatattacc
gaacaggttgggttagggtctattgtcactattcgtcatgttgatactcaaggtggatac
ttgcattcacatgaacatttctatcagacaggttcaaagcaacaacaaattactttgtat
cctcatttggactctaacaacaagtggttgattgaaccttacaatggcaccattcataat
gaaacttttgttcctttaatcaacggtatgaaaattagattgaagcatattaacactggt
agaagattgcattcacatgatgaaaaacctccagttagtgaacgtgactggcagaaggaa
tgttcatgttatgggtacgatggatttgccggtgatgcaaatgatgattgggtggttgaa
attgtcaattatagatcacaaaagggtgaagctcaaacatttgtcaaggccatcaacact
attttcagattaagacatgccatgactggacactatttattttctagtgaagtgaaattg
ccagaatggggatttggtcaacaagaagtcaccagtgcttcacaaggtaaacgttctttg
acacattggtatattgaaaccaatgaaaataatatattgcctccatcagaagccaagatt
attaattatcctaaattatcactttggcaaaaagttgttgaatcacacaagagaatgtgg
aagattaatcaaggattaacttcacatcatcattggcaatctagtccttctgaatggcca
ttattgttgagaggtatcaattattggaacaaagaacacaaacaagtatatttgttgggt
aatgctgttacctggtgggctgccactttgtcaattatcacttttggaacctatgtcttg
attgctgtttttagatggcatcttggtacacctttgtcatcaaataaacatgttttcaat
ttcaatgttcaaactttctcatatgttttaggatgggcattacattaccttccatttttc
attatgggtagacaattgtttttacatcattatttgccagcattatattttggtattttg
gctttgggacactttttcgaaattttcactggttatttgacttcccgttccaaatatttc
caacaagtggcatttgtattggtgggattgttttccattttgagtttagtgttttacgtc
aattattcatcattaatctacggtactccttggaccaaaggaagctgtgaattgaccaaa
ccatttagtggttgggattataactgtggcacttttttcgaaactttaggtgaatatgac
attcaagataaatcattggcttcagaatctgaaataccaacagaaacagtagttgttgaa
gctaaacaaactcctaaagctgaaccaagattggctaaacaagatgatcatattgaatct
cctcctgctgctgctgcagaacctgttgaagtcaaagaagtcaaagaagaaattgaacaa
ttggcaccaccattagctgttgattttgaagaagaaactccgaaagtggaagatccgcag
gtggttgacgtagatgcttctagtaacgatgaaaaatctgttgaagaaaagcaacaagaa
caaccacaagaagatgaagatgaatcagtgcaacagcgccaacaatag

DBGET integrated database retrieval system