KEGG   Candida dubliniensis: CD36_72780Help
Entry
CD36_72780        CDS       T01140                                 

Gene name
DFR1
Definition
dihydrofolate reductase, putative (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cdu  Candida dubliniensis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cdu00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:cdu00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(719020..719598)
Genome map
AA seq 192 aa AA seqDB search
MSKPNVAIIVAALKPALGIGYQGKMPWRLRKEIRYFKDVTTKTTRPGTRNAVIMGRKTWE
SIPQKFRPLPDRLNIILSRSYKNEIIDDNIVHASSIESSLNLVSDVERVFIIGGAEIYNE
LINNSLVTHLLITEIEHPDPESIEMDTFLKFPLESWTKQPKSELQKFVGDTLLEDNITEG
DFTYNYTLWTRK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaccaaacgttgcaattattgttgcggcactaaagcctgctttgggaattgga
taccaaggtaaaatgccttggagacttcgtaaggaaataagatatttcaaggacgtcact
acgaaaacaacgaggccaggtactcgtaatgctgttattatgggtagaaaaacttgggag
tctataccacaaaagtttagacctcttccagatagattaaatataatattatccagatca
tataaaaatgaaattattgatgacaacatcgttcatgctagctcaatcgaatcgtcactt
aatctcgtatctgatgttgaaagagttttcataattggaggggcagaaatttacaatgaa
ttgataaataattctttagtgactcatctattaatcacagaaattgaacacccagatcca
gagtctatcgaaatggatacatttttgaaattcccattagaaagttggaccaagcaacca
aaatcggagttgcaaaaatttgtcggagatactttattagaagacaatatcacggaaggt
gatttcacctataattatacgctatggacaagaaaataa

DBGET integrated database retrieval system