KEGG   Candida dubliniensis: CD36_73170Help
Entry
CD36_73170        CDS       T01140                                 

Definition
nicotinamidase, putative (EC:3.5.1.19)
Orthology
K01440  
nicotinamidase [EC:3.5.1.19]
Organism
cdu  Candida dubliniensis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CD36_73170
Enzymes [BR:cdu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     CD36_73170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:825299..826030
Genome map
AA seq 243 aa AA seqDB search
MKKTALIIVDLQEDFLPPNGSLAIKNGRSVIPKINQLLPSPDKQNSIDWSLIVATKDWHP
PNHTSFASQHDNVSPFTEIEFIHPEKKLDPKTNQPIVMNQIVWPDHCVQGTKGAQLEPSF
ANQFEKLSEQNSNAVPHKIVEKGYLPDREYYSCFQDCWGLHHTELIDLLHEYDIENVVFV
GLAYDFCVLRSAIDSVKNGFKTFVLKNYCESVYPEKINDTDKLYTDNGVIIVGSDEKVDR
LFN
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaacagcattgataatagttgatttgcaagaggatttcttaccaccaaatgga
tcattagccattaaaaatgggcgatcagtgatacccaaaatcaaccaattattaccatca
cccgataaacaaaatagcattgattggtcattgattgttgcaactaaagattggcatcca
cccaatcatacttcatttgcctctcaacatgacaatgtttcaccatttactgaaattgaa
ttcattcatccagaaaagaaattagaccccaaaactaatcaacctattgttatgaatcaa
attgtttggccagatcattgtgtacaaggtaccaaaggagcacaattggaacctctgttt
gctaatcaattcgaaaaactttccgaacaaaatagtaacgctgttccacataaaattgtg
gagaagggatatctacctgatcgtgaatattattcctgtttccaagattgttgggggtta
catcatactgaattaattgatcttttacatgagtatgatattgaaaatgtcgttttcgtg
gggttagcttatgatttctgtgttttgagatcagctattgatagtgtaaaaaatggattc
aaaacatttgtattgaaaaattattgtgaatcagtttatccagagaaaattaatgacaca
gataagctatatactgataatggtgttatcatagttggtagtgatgaaaaagttgatcgt
ttatttaactaa

DBGET integrated database retrieval system