KEGG   Candida dubliniensis: CD36_73380Help
Entry
CD36_73380        CDS       T01140                                 

Gene name
PLC1
Definition
1--phosphatidylinositol-4,5-bisphosphate phosphodiesterase 1, putative (EC:3.1.4.11)
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
cdu  Candida dubliniensis
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:cdu00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:cdu04070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(872733..876050)
Genome map
AA seq 1105 aa AA seqDB search
MFELSNSRNSIDSNQGDNDNDNQSNDELSPSELYYSPTGSPPKSQLLLQKSSSPSSYSPI
KSDLPNIYSHLRSNDNNIDPLSPQSPPPPPQPPQPSSSSSSNTKSSTAKNIFKKLLRFNK
SSDNINDSRSIVSTNGGSPINENTTTTTTATATTMTSSSSNNSIPKRGKSIQRSQILHHT
DSDSLYLENQIELRPEISKSIGNIKIGNIFTNDGMPLLKISHKSKKRILFWIDPSCFKFS
WRMANSITNTTSGLLPQSIINNTPLLSNSTIITTSTITTSTLHRLSISNRTTHEFFLDDI
KSIYIQNEGSGYREELNISQKLENNWITIIYFNQKKNNLKSLHLITDNNHDFKKLISAIY
NLKQLRSQLAKEFLIDINELDENYIKMLLNKELPTNDDDGDDNGDGYGDGQKSHKHVREF
LSFNDILKYAKRLNINVNTNHLQQIFDQVILLSTSSTTDKLINSPSFEKGLNFEQFKQFV
SILKDRKDLQEIWDSLAKNKNVLNFNDIKNFIINIQKDNFDDNTINLIFQKYCNIDNGWN
KESLNEYLLSSYSTPYREITHNSNNNYYDYPLNEYFISSSHNTYLTGRQVAGDSSVEGYI
RTLQRGCRCVEIDIWNGDSNDTGSDVKNESEPIVNHGRTFTKPISFINVIKAIKKFAFIV
SPWPLILSLEIHCSPECQIKVVNILKDILGENMIIAPIDIDSMVLPSPTQLKHKFIIKVK
KTTSFQNLVETENGNFTTTTTTTTTTTTTATSLSEDNEINKSNNNSNTSSSSSSSFIMRR
RKGNKSPKIINELSDLGIYTQGIKFRNFSLPESKTFNHCFSLGEKSINRMIKDDDKKISL
NKHNRRYLMRVYPSGTRLKSSNFNPLPYWSHGVQMVATNWQTYDLGQQLNESLFENKIFQ
GYVLKPKLLRKPILKSTNDFNKSSIINNNNNNNCKVIRFNFEIISGHQLPKFPKDDYKDQ
AINPYISFEIIGAQNIQWDNNNTNESISSSTTTTTTTSITNSDTIRTTKIIGENGFNPNF
NSKFSGSIITLNDLIFIKFIVYASTSLNYPDSGEIFPIGILVTKLNYLKQGYRYIYLNDL
LGEQLVYSSIFIKIEYDEDLLNELS
NT seq 3318 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaattatcaaattctcgaaattcaattgatagtaatcaaggtgataacgataat
gacaatcaaagtaatgatgaattaagtccttcagaattatattattctccaacaggactg
cctcctaaatcacaattattacttcaaaaatcatcttcaccttcatcatattctccaatt
aaatctgatttacctaatatttatagtcatttacgatctaatgataataatattgatcca
ctactgccacagtcaccaccaccaccaccacaaccaccacaaccttcatcatcatcatca
tcaaatactaaatcttcaacagcaaagaatatttttaaaaaattattacgatttaataaa
tcatcagataatattaatgattcaagatcaattgtactgaccaatggtgggtctcctatt
aatgagaataccaccaccaccaccaccgccaccgccaccacaatgacatcaagttcatct
aataatagcattcctaaacgagggaaatctattcaacgaagtcaaattctacatcacacc
gattctgattctttatatttagaaaatcaaattgaattacgtccagaaatatctaaatca
attggtaatattaaaattggtaatatatttactaatgatggaatgccattattaaaaata
tctcataaatcaaagaaaagaatattattttggattgatccttcatgttttaaattttct
tggagaatggccaattcaattaccaatacaacttcaggtttattacctcaaagtatcatt
aataatactccattattatctaattcaacaattattactacatcaacaataacaacttca
actcttcatcgattatcaatatctaatcgaactactcatgaattttttcttgatgatatt
aaatcaatatatattcaaaatgaaggtagtggatatcgtgaagaattaaatatatctcaa
aaacttgaaaataattggattacaataatttattttaatcaaaaaaaaaataatttaaaa
tcattacatttaattactgataataatcatgattttaaaaaattgattctggcaatttat
aatttaaaacaattacgttcacaattggccaaagaatttttaattgatataaatgaatta
gatgaaaattatattaaaatgttattaaataaagaattaccaactaatgatgatgatggt
gatgataatggtgatggttatggtgatggtcagaaatctcataaacatgttagagaattt
cttagttttaatgatattttaaaatatgccaaaagattaaatattaatgtcaataccaat
catttacaacaaatttttgatcaagtaatattactatcaacatcatcaacaacagataaa
cttatcaatagtccctcatttgaaaaaggattaaattttgaacaatttaaacaatttgtt
tcaatacttaaagatcggaaagatttacaagaaatttgggattcattagcaaaaaataaa
aatgtattaaattttaatgatattaaaaattttattattaatattcaaaaagataatttt
gatgataataccattaatttaattttccaaaaatattgtaatattgataatggatggaat
aaagaaagtttaaatgaatatttattatcaagttattcaactccatatcgtgaaatcact
cataatagtaacaacaattattatgattatccattaaatgaatatttcatttcatcatct
cataatacttatttaactggtcgacaagttgctggtgattcatcagtagaaggatatatt
agaacattacaacgtggatgtcgatgtgttgaaattgatatttggaatggcgatagtaat
gatactggttcagatgttaagaatgaatcagaaccaatagttaatcatggaagaactttt
actaaaccaataagttttattaatgttattaaagcaattaaaaaatttgcttttattgta
tcaccttggccattaatacttagtttagaaattcattgttcaccagaatgtcaaattaaa
gttgttaatattttaaaagatattcttggtgaaaatatgattattgctccaattgatatt
gattcaatggtattaccatcaccaactcaattgaaacataaatttattattaaagtgaaa
aaaacaacatcatttcaaaatttagtagaaactgaaaatggcaatttcaccaccacaacc
acaaccaccaccaccaccaccaccactgcaacttcattaagtgaagataatgaaattaat
aaatccaataataatagtaatacatcatcatcatcatcatcatcatttattatgagacga
agaaaaggaaataaatcacctaaaataataaatgaattaagtgatcttggtatatatact
caaggaataaaatttcgtaatttttcattaccagaatctaaaacttttaatcattgtttt
tcattaggagaaaaatctattaatcgaatgattaaagatgatgataaaaaaatttcttta
aataaacataatcgtcgttatttaatgagagtttatccttcaggaacaagattaaaatca
tcaaattttaatccattaccttattggtctcatggagtacaaatggtggcaacaaattgg
caaacttatgatttaggtcaacaattaaatgaatcattatttgaaaataaaattttccaa
ggatatgtattaaaaccaaaattattaaggaaaccaattttaaaatcaactaatgatttt
aataaatcttcaataattaataataataataataataattgtaaagtaattcgatttaat
tttgaaattattagtggtcatcaattaccaaaatttcctaaagatgattataaagatcaa
gcaattaatccatatatatcatttgaaattattggtgctcaaaatattcaatgggataat
aataataccaatgaatccatatcatcatcaacaacaacaacaacaacaacaagtattact
aatagtgatactattaggacaacgaaaataattggtgaaaatggatttaatccaaatttt
aatagtaaatttagtggatcaattataacattaaatgatttaatatttataaaatttatt
gtttatgcatcaacttcattaaattatcctgattcaggagaaattttccctataggtata
ttagtaacaaaattaaattatttaaaacaagggtatagatatatttatttaaatgattta
ttaggtgaacaattggtttattcttcaatttttataaaaattgaatatgatgaagattta
ttaaatgaattaagctag

DBGET integrated database retrieval system